KEGG   Acinonyx jubatus (cheetah): 106983998
Entry
106983998         CDS       T04657                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01521  EGFR tyrosine kinase inhibitor resistance
aju04010  MAPK signaling pathway
aju04014  Ras signaling pathway
aju04015  Rap1 signaling pathway
aju04020  Calcium signaling pathway
aju04072  Phospholipase D signaling pathway
aju04144  Endocytosis
aju04151  PI3K-Akt signaling pathway
aju04510  Focal adhesion
aju04540  Gap junction
aju04630  JAK-STAT signaling pathway
aju04810  Regulation of actin cytoskeleton
aju05163  Human cytomegalovirus infection
aju05200  Pathways in cancer
aju05206  MicroRNAs in cancer
aju05214  Glioma
aju05215  Prostate cancer
aju05218  Melanoma
aju05230  Central carbon metabolism in cancer
aju05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106983998 (PDGFRA)
   04014 Ras signaling pathway
    106983998 (PDGFRA)
   04015 Rap1 signaling pathway
    106983998 (PDGFRA)
   04630 JAK-STAT signaling pathway
    106983998 (PDGFRA)
   04020 Calcium signaling pathway
    106983998 (PDGFRA)
   04072 Phospholipase D signaling pathway
    106983998 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    106983998 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106983998 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106983998 (PDGFRA)
   04540 Gap junction
    106983998 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106983998 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106983998 (PDGFRA)
   05206 MicroRNAs in cancer
    106983998 (PDGFRA)
   05230 Central carbon metabolism in cancer
    106983998 (PDGFRA)
   05231 Choline metabolism in cancer
    106983998 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    106983998 (PDGFRA)
   05218 Melanoma
    106983998 (PDGFRA)
   05215 Prostate cancer
    106983998 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    106983998 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106983998 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aju01001]
    106983998 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:aju04090]
    106983998 (PDGFRA)
Enzymes [BR:aju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     106983998 (PDGFRA)
Protein kinases [BR:aju01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   106983998 (PDGFRA)
CD molecules [BR:aju04090]
 Proteins
  106983998 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 106983998
NCBI-ProteinID: XP_014937685
UniProt: A0A6J0A623
LinkDB
Position
Unknown
AA seq 1089 aa
MGTSHLALLVLVCLLTGPSLISCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYP
MSEEENPNVEVRNEENNSGLFVTVLEVVNASAAHTGLYTCYYNHTQTDENEIEGRRIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPKTPVTLRSSDGVVHASYDSRQGFNG
TFSVGPYICEATVSGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATKEVK
EMKKVTISVHEKGFIEIKPNFSPLEAVDLHEVKHFVVDVQAYPPPRISWLKDNLTLIENL
TEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTVLANNISNIITEVHRRD
RSTVEGRVTFTRVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSTSDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKNGYRMAKPDHATSEVYEIMVKCWHSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKHEEDKLKDWEGSLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFVKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccacctggcgctcctggtgttagtctgtctcctcacaggaccgagccta
atctcctgccagctttcattaccctctatccttccaaatgaaaatgaaaaggtcgtgcag
ctgaattcctccttttctctgcgatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaaccccaatgtggaagtcagaaatgaagaaaacaacagtggcctt
tttgtgacggtgctggaagtggtcaatgcgtcggcggcccacacgggactgtacacttgc
tattacaaccacactcagacggacgaaaacgagatcgaaggcaggcgcatttacatctat
gtcccagacccagacgtagccttcgtacctctaggaatgacagattatttagttatcgtg
gaggacgatgactctgccatcataccttgtcgcacaactgatcccaagactccggttacc
ttacgcagcagtgacggggtggtacacgcctcctatgacagcagacagggctttaatggg
accttcagcgtcgggccctatatctgcgaagccacagtcagcgggaagaagttccagacc
atcccatttaatgtttatgctttaaaagcaacatcagaacttgatctagaaatggaagct
ctcaaaactgtctataagtcaggggagacgattgtggtcacctgcgccgtctttaacaac
gaggtggttgaccttcagtggacttaccctggagaagtgaaaggcaaaggcatcacgatg
ctggaggagatcaaggtcccgtccatcaaactggtttacactctgacggtccccgaggcc
acggtgaaggatagtggagattatgaatgtgctgcccgccaggccaccaaggaggtcaaa
gagatgaagaaagtcaccatttccgtccatgagaaagggttcattgaaatcaaacccaac
ttcagcccgttggaggctgttgacctgcatgaagtcaaacatttcgtggtggacgtgcag
gcctacccccctcccaggatatcctggctgaaggacaacctgactctgattgaaaatctc
acggagatcaccaccgacatagaaaagattcaggaaataaggtatcgaagcaaattaaag
ctgatccgtgcgaaggaagaagacagtggccattacactattgtcgtccaaaatgaagat
gacgtgaagagctatactttcgaactcttaacgcaagttccctcgtctattctggacttg
gtcgacgaccaccatggctccaccgggggacagactgtgagatgcacagcagaagggaca
cctcttcctgatatcgagtggatgatttgcaaggatattaagaaatgtaataacgaaact
tcatggacggttttggcgaacaacatctcgaacatcatcacggaggtccaccgccgggac
aggagtactgtggagggccgagtgacgttcaccagagtggaggagaccatcgccgttcga
tgcctggccaagaatcttcttggagccgagaaccgagagctgaagctggtggctcccacg
ctgcgttctgaactcacagtggcggctgcagtcctggtcctgctggtgattgtgatcatc
tccctcattgtcctggttgtcatttggaaacagaaaccgaggtatgaaattcgttggagg
gtcattgaatcgatcagccccgatggacatgaatatatttacgtggacccgatgcagctg
ccttatgactctagatgggagtttccaagagatggactagtgcttggtcgtatcctggga
tctggtgcgttcgggaaagtggtcgaaggaactgcctatggattgagccggtcccagcct
gtcatgaaagtagcagtaaagatgctaaaacccacagccagatccagtgaaaaacaagct
ctcatgtcggaactgaagataatgactcacctggggccccatttaaacattgtgaacttg
ctgggggcctgcaccaagtcaggccctatttacatcatcacggagtactgcttctatggg
gatttggtcaactatttgcataagaatagggacagcttcctgagccgacacccagagaag
ccaaagaaagagttggacatttttgggctgaaccctgctgatgaaagcacacggagttac
gttattttatcttttgaaaacaatggtgactatatggacatgaagcaagctgataccaca
cagtacgtccccatgctggaaaggaaagaggtttctaaatactcggacatccagagatcg
ctgtatgatcgcccggcctcgtataagaagaaatctacatcagactcggaagtcaaaaac
ctcctttcggacgataactcagaaggcctgactctgctggatttgttgagctttacctat
caagtggcgcgagggatggaatttttggcttccaaaaattgtgtccaccgggacctggct
gctcgcaacgtcctcctggcgcaagggaaaatcgtgaagatctgtgactttggcctggcc
agggacatcatgcacgattcaaactacgtgtccaaaggcagcacctttctccctgtgaag
tggatggctcctgagagcatcttcgacaacctctacaccacgctgagtgacgtctggtct
tacggcattctgctctgggagatcttttcccttgggggcaccccgtaccctggcatgatg
gtggattccactttctacaacaagatcaagaatgggtaccggatggccaagcctgaccac
gccaccagtgaagtctatgaaatcatggtcaagtgctggcacagtgagccggagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgttgccgggacaatataagaag
agctacgaaaagattcacctggacttcttgaagagcgaccaccctgccgtggcgcgcatg
cgcgtggactcggacaacgcctacatcggcgtcacctacaaacacgaggaagacaagctg
aaggactgggaaggcagcctggacgagcagaggctgagtgcagacagcggctacatcatc
cctctgcccgacatcgaccctgttcctgaggaggaggacctgggcaagaggaacagacac
agctcgcagacctcagaagagagtgccattgagacaggttccagcagctctaccttcgtc
aagagagaggatgaaaccatcgaggacatcgacatgatggatgacattggcatagactcc
tcagacctggtagaggacagcttcctgtga

DBGET integrated database retrieval system