KEGG   Acinonyx jubatus (cheetah): 106984570
Entry
106984570         CDS       T04657                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04010  MAPK signaling pathway
aju04060  Cytokine-cytokine receptor interaction
aju04068  FoxO signaling pathway
aju04144  Endocytosis
aju04218  Cellular senescence
aju04350  TGF-beta signaling pathway
aju04380  Osteoclast differentiation
aju04390  Hippo signaling pathway
aju04520  Adherens junction
aju04659  Th17 cell differentiation
aju04926  Relaxin signaling pathway
aju04933  AGE-RAGE signaling pathway in diabetic complications
aju05142  Chagas disease
aju05161  Hepatitis B
aju05166  Human T-cell leukemia virus 1 infection
aju05200  Pathways in cancer
aju05202  Transcriptional misregulation in cancer
aju05210  Colorectal cancer
aju05212  Pancreatic cancer
aju05220  Chronic myeloid leukemia
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106984570 (TGFBR2)
   04350 TGF-beta signaling pathway
    106984570 (TGFBR2)
   04390 Hippo signaling pathway
    106984570 (TGFBR2)
   04068 FoxO signaling pathway
    106984570 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106984570 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106984570 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    106984570 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106984570 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    106984570 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    106984570 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    106984570 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106984570 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    106984570 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106984570 (TGFBR2)
   05212 Pancreatic cancer
    106984570 (TGFBR2)
   05225 Hepatocellular carcinoma
    106984570 (TGFBR2)
   05226 Gastric cancer
    106984570 (TGFBR2)
   05220 Chronic myeloid leukemia
    106984570 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106984570 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106984570 (TGFBR2)
   05161 Hepatitis B
    106984570 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    106984570 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aju01001]
    106984570 (TGFBR2)
Enzymes [BR:aju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     106984570 (TGFBR2)
Protein kinases [BR:aju01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   106984570 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 106984570
NCBI-ProteinID: XP_026896657
UniProt: A0A6J1XVP4
LinkDB
Position
Unknown
AA seq 567 aa
MGRGLLRGLWPLHIVLWTRIASTIPPHVLKSVNNGMMVTDNNGIIKFPQLCKFCDVRSST
CDSQKSCLSNCSITSICERPHEVCLAVWRKNDENITLETLCHDPKVTYHGIALEDSASPK
CIMKEKKVLGETFFMCSCSTDECNDYIIFSEEYATNNPDLLLVIFQVTGVSLLPPLGIAI
AVIIIFYCYRVHRQQKLSPSWDTSKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDVNLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRTLGSSLARGIAH
LHSDHTLCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKEYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSSWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSE
LQHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctccggggcctgtggccgctgcacatcgtcctgtggacgcgcatc
gccagcacgatcccgccgcacgttctgaagtccgttaacaatggcatgatggtcaccgac
aacaatggtatcatcaagtttccgcaattgtgcaaattttgtgatgtgagatcttccacc
tgtgacagccagaaatcctgcctgagcaactgcagcatcacgtctatctgcgagaggcca
cacgaagtctgtctggccgtctggagaaagaatgatgagaacataaccctagagacgctt
tgccatgaccccaaggttacctaccatggaattgctcttgaagactctgcttctcccaag
tgtattatgaaggaaaaaaaggtgttgggcgagactttctttatgtgttcctgtagcacc
gatgaatgcaatgactacatcatcttctcagaagaatacgccaccaacaaccctgacctg
ttgttagtcatattccaagtgacaggcgtcagcctcctgccccccctggggatcgccata
gccgtcatcatcatcttctactgctaccgtgttcaccggcagcagaagctgagcccatcc
tgggataccagcaagccacgaaagctcatggagttcagcgagcaccttgccatcattctg
gaagacgaccgctctgatatcagctctacctgcgccaacaacatcaaccacaacacagag
ctgctgcccattgagctggacaccctggtggggaagggccgcttcgccgaggtctacaag
gccaagctgaagcagaacacttctgaacagttcgagaccgtggccgtcaagatcttccct
tacgaggagtacgcctcctggaagacggagaaggacattttctcagacgtcaacctgaag
cacgagaacatactgcagttcctgacagccgaggagcgcaagacggagctggggaagcag
tactggctgatcacggccttccacgccaagggcaacctgcaggagtacctgacgcggcac
gtcatcagctgggaggacctgcgcacgctgggcagctccctcgcccggggcattgcccac
ctgcacagcgaccacaccctgtgcgggaggcccaagatgcccatcgtgcacagggacctc
aagagctccaatatcctcgtcaagaatgatctgacctgctgcctgtgtgactttgggctt
tccctgcgtctggacccgaccctgtctgtggatgacctggccaacagcgggcaggtggga
actgcaagatacatggctccagaagtcctagagtccaggatgaatttggagaatgttgag
tcctttaagcagacggatgtctactccatggctctggtcctctgggaaatgacatctcgc
tgtaatgcggtgggagaggtgaaagagtacgagcctccatttggttccaaggtgcgggag
catccctgtgttgagagcatgaaggacaatgtgctgagagaccgaggacgaccagaaatt
cctagctcctggctcaaccaccagggcatccagatggtgtgcgagactctgaccgagtgc
tgggaccatgacccggaggcccggctcacggcccagtgcgtggcagagcgcttcagtgaa
ctgcagcacctggacaggctctcggggaggagctgctccgaggagaagattcccgaagat
ggctcgttgaacactaccaaatag

DBGET integrated database retrieval system