KEGG   Acinonyx jubatus (cheetah): 106985126Help
Entry
106985126         CDS       T04657                                 

Gene name
LPCAT1
Definition
(RefSeq) lysophosphatidylcholine acyltransferase 1 isoform X1
  KO
K13510  lysophosphatidylcholine acyltransferase / lyso-PAF acetyltransferase [EC:2.3.1.23 2.3.1.67]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00564  Glycerophospholipid metabolism
aju00565  Ether lipid metabolism
aju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    106985126 (LPCAT1)
   00565 Ether lipid metabolism
    106985126 (LPCAT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aju01004]
    106985126 (LPCAT1)
Enzymes [BR:aju01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     106985126 (LPCAT1)
    2.3.1.67  1-alkylglycerophosphocholine O-acetyltransferase
     106985126 (LPCAT1)
Lipid biosynthesis proteins [BR:aju01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   106985126 (LPCAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyltransferase EF-hand_8 EF-hand_6 EF-hand_7 EF-hand_1 JmjN
Motif
Other DBs
NCBI-GeneID: 106985126
NCBI-ProteinID: XP_026929489
LinkDB All DBs
Position
Unknown
AA seq 533 aa AA seqDB search
MRLRARGPRVAPASGAGACDARRLAPPGRNPFVHELRLGALRKAQMAFMTLTLFPIRLLL
VLIAMLLAWPFTFFATLGSSEREPEPSPASWRKVVDVLLKAIMRTMWFAGGFHWVVVKGQ
QAPPSEAAILTLAPHSSYFDAIAVTMTMSSIVMKAESRNIPIWGTLIKYIRPVFVSRSDQ
DSRRKTVEEIRRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGVPVQPVVLRYPN
KLDTITWTWQGPGALKILWLTLCQFHNRVEIEFLPVYSPSDEEKKDPALYASNVRRVMAE
ALGVSVTDYTYDDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPETLEKDLDKYSDRAQ
TQGGRRVGLPEFAEYLGVPVSDTLQDLFSLFDESGDDTMDPREYVVALSVVCRPSRTLDT
IQLAFRMYGSQDGCIDEGALSSILKTALGVAELTVTDLFRAIDEEETGRITFADFRRFAE
AFPDFAEEYLYPDQTRPESCPQTPPAPAPNGFCADFSPENSGVGRKPFRKKLD
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgcgggcgcgcggtccccgggtcgcccccgcctccggcgcgggggcctgcgac
gcgcggcggctggcgcccccggggcggaaccccttcgtgcacgagctgcgcctcggcgcc
ctgcggaaggcccagatggccttcatgacgctgacactcttccccatccggctgctgctc
gtcctgatcgcgatgctgctcgcctggcccttcacgttcttcgccacgctggggtcctcg
gagagggagcccgagccgtccccggcctcatggcggaaggtcgtggacgtcctgctcaag
gccatcatgcgcaccatgtggtttgccggaggcttccactgggtggtggtgaaggggcag
caggccccaccctctgaggctgccatcctcactctggcgccccattcctcctacttcgac
gccatcgctgtcaccatgacgatgtcctccattgtgatgaaggcagagagcaggaacatc
ccaatatggggaactctgataaagtacatccggccggtgttcgtgtcccggtcggaccag
gattcccgcaggaagaccgtggaggagatcaggaggcgggcacagtcgaacggaaagtgg
ccgcagatcatgatttttccagaaggaacatgtactaacaggacgtgcctaattaccttc
aagcctggtgcgttcatcccaggagttcctgtccagcctgtggttctgcggtacccgaac
aaactggacaccatcacgtggacgtggcaaggacctggagcgttgaaaatcctgtggctc
acgctctgtcagtttcacaatcgagtggaaatcgagttccttcccgtgtacagcccctcg
gacgaggagaagaaggacccggccctgtatgccagcaacgtgcggcgcgtcatggcagag
gccctgggcgtctcggtgaccgactacacgtatgacgattgccaactggccctggcggaa
ggccagctccgtctccccgcggacacctgccttctcgagttcgcccggctggtgaggggc
ctggggttgaaaccagaaacactggagaaagatctggataaatactccgaccgggcccag
acgcaggggggacgcagggtgggcctccccgagttcgccgagtacctgggcgtccccgtc
tcagacacactacaagacctgttctccctgtttgatgagagtggagatgacacaatggat
cctcgggaatatgtcgtcgccctgtccgtcgtctgccggccgtcccggactctggacacc
atccagctggcattcaggatgtacgggtcacaggacggctgcatcgatgaaggcgccctg
tccagcatcctcaagaccgccttaggcgtggccgagctcaccgtgaccgacctcttccgg
gccatcgacgaggaggagacggggaggatcacgtttgccgacttccgcaggtttgcagaa
gcgttccccgactttgcagaggagtacctctaccctgaccagacgcgtcctgagagctgc
ccacagacgcccccagctccagcccccaacggcttctgtgctgacttcagccctgaaaac
tcgggcgttgggaggaaacctttccggaagaaactggactag

DBGET integrated database retrieval system