KEGG   Acinonyx jubatus (cheetah): 106985187
Entry
106985187         CDS       T04657                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01521  EGFR tyrosine kinase inhibitor resistance
aju01522  Endocrine resistance
aju01524  Platinum drug resistance
aju04064  NF-kappa B signaling pathway
aju04066  HIF-1 signaling pathway
aju04071  Sphingolipid signaling pathway
aju04115  p53 signaling pathway
aju04140  Autophagy - animal
aju04141  Protein processing in endoplasmic reticulum
aju04151  PI3K-Akt signaling pathway
aju04210  Apoptosis
aju04215  Apoptosis - multiple species
aju04217  Necroptosis
aju04261  Adrenergic signaling in cardiomyocytes
aju04340  Hedgehog signaling pathway
aju04510  Focal adhesion
aju04621  NOD-like receptor signaling pathway
aju04630  JAK-STAT signaling pathway
aju04722  Neurotrophin signaling pathway
aju04725  Cholinergic synapse
aju04915  Estrogen signaling pathway
aju04928  Parathyroid hormone synthesis, secretion and action
aju04933  AGE-RAGE signaling pathway in diabetic complications
aju05014  Amyotrophic lateral sclerosis
aju05022  Pathways of neurodegeneration - multiple diseases
aju05132  Salmonella infection
aju05145  Toxoplasmosis
aju05152  Tuberculosis
aju05161  Hepatitis B
aju05162  Measles
aju05168  Herpes simplex virus 1 infection
aju05169  Epstein-Barr virus infection
aju05170  Human immunodeficiency virus 1 infection
aju05200  Pathways in cancer
aju05206  MicroRNAs in cancer
aju05210  Colorectal cancer
aju05215  Prostate cancer
aju05222  Small cell lung cancer
aju05226  Gastric cancer
aju05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106985187 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106985187 (BCL2)
   04630 JAK-STAT signaling pathway
    106985187 (BCL2)
   04064 NF-kappa B signaling pathway
    106985187 (BCL2)
   04066 HIF-1 signaling pathway
    106985187 (BCL2)
   04071 Sphingolipid signaling pathway
    106985187 (BCL2)
   04151 PI3K-Akt signaling pathway
    106985187 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106985187 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    106985187 (BCL2)
   04215 Apoptosis - multiple species
    106985187 (BCL2)
   04217 Necroptosis
    106985187 (BCL2)
   04115 p53 signaling pathway
    106985187 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106985187 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    106985187 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    106985187 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    106985187 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106985187 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    106985187 (BCL2)
   04722 Neurotrophin signaling pathway
    106985187 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106985187 (BCL2)
   05206 MicroRNAs in cancer
    106985187 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106985187 (BCL2)
   05226 Gastric cancer
    106985187 (BCL2)
   05215 Prostate cancer
    106985187 (BCL2)
   05222 Small cell lung cancer
    106985187 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    106985187 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    106985187 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    106985187 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106985187 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106985187 (BCL2)
   05152 Tuberculosis
    106985187 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    106985187 (BCL2)
   05161 Hepatitis B
    106985187 (BCL2)
   05162 Measles
    106985187 (BCL2)
   05168 Herpes simplex virus 1 infection
    106985187 (BCL2)
   05169 Epstein-Barr virus infection
    106985187 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    106985187 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106985187 (BCL2)
   01524 Platinum drug resistance
    106985187 (BCL2)
   01522 Endocrine resistance
    106985187 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aju01009]
    106985187 (BCL2)
Protein phosphatases and associated proteins [BR:aju01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106985187 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 106985187
NCBI-ProteinID: XP_026924932
UniProt: A0A6J2A563
LinkDB
Position
Unknown
AA seq 237 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPA
RTSPPPPPVAPAAAAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLT
PFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLN
RHLHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
NT seq 714 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtatgataaccgggagatagtcatgaagtacatccac
tataagctgtcgcagaggggctacgagtgggatgccggggacgcgggcgccgcgcccccg
ggggccgcccccgcgccgggcatcttctcctcccagcccgggcgcacccctgcgcccgcc
aggacctccccgccgccgcccccggtcgcccccgccgccgccgccgccgccgccgccgcg
ggccctgcgctcagccccgtgccacctgtggtccacctgaccctgcgccaggccggcgat
gacttctcccgtcgctaccgccgcgacttcgcggagatgtccagccagctgcacctgaca
ccctttaccgcaaggggacgctttgccacggtggtggaggagctcttcagggatggagtg
aactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtc
aaccgagagatgtcgcccctggtggacaacatcgccctgtggatgactgagtacctgaac
cggcacctgcacacctggatccaagacaacggaggctgggatgcctttgtggaactgtac
ggccccagcatgcagcctctgtttgatttctcctggctgtccctgaaggccctgctcagt
ctggccctggtgggggcttgcatcaccctgggtgcctatctgggccacaagtga

DBGET integrated database retrieval system