Acinonyx jubatus (cheetah): 106985187 Help Entry 106985187         CDS       T04657                                  Gene name BCL2 Definition (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism aju  Acinonyx jubatus (cheetah) Pathway aju01521   EGFR tyrosine kinase inhibitor resistance aju01522   Endocrine resistance aju01524   Platinum drug resistance aju04064   NF-kappa B signaling pathway aju04066   HIF-1 signaling pathway aju04071   Sphingolipid signaling pathway aju04115   p53 signaling pathway aju04140   Autophagy - animal aju04141   Protein processing in endoplasmic reticulum aju04151   PI3K-Akt signaling pathway aju04210   Apoptosis aju04215   Apoptosis - multiple species aju04217   Necroptosis aju04261   Adrenergic signaling in cardiomyocytes aju04340   Hedgehog signaling pathway aju04510   Focal adhesion aju04621   NOD-like receptor signaling pathway aju04630   JAK-STAT signaling pathway aju04722   Neurotrophin signaling pathway aju04725   Cholinergic synapse aju04915   Estrogen signaling pathway aju04928   Parathyroid hormone synthesis, secretion and action aju04933   AGE-RAGE signaling pathway in diabetic complications aju05014   Amyotrophic lateral sclerosis aju05022   Pathways of neurodegeneration - multiple diseases aju05132   Salmonella infection aju05145   Toxoplasmosis aju05152   Tuberculosis aju05161   Hepatitis B aju05162   Measles aju05168   Herpes simplex virus 1 infection aju05169   Epstein-Barr virus infection aju05170   Human immunodeficiency virus 1 infection aju05200   Pathways in cancer aju05206   MicroRNAs in cancer aju05210   Colorectal cancer aju05215   Prostate cancer aju05222   Small cell lung cancer aju05226   Gastric cancer aju05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aju00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     106985187 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     106985187 (BCL2)    04630 JAK-STAT signaling pathway     106985187 (BCL2)    04064 NF-kappa B signaling pathway     106985187 (BCL2)    04066 HIF-1 signaling pathway     106985187 (BCL2)    04071 Sphingolipid signaling pathway     106985187 (BCL2)    04151 PI3K-Akt signaling pathway     106985187 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106985187 (BCL2)   09143 Cell growth and death    04210 Apoptosis     106985187 (BCL2)    04215 Apoptosis - multiple species     106985187 (BCL2)    04217 Necroptosis     106985187 (BCL2)    04115 p53 signaling pathway     106985187 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     106985187 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     106985187 (BCL2)   09152 Endocrine system    04915 Estrogen signaling pathway     106985187 (BCL2)    04928 Parathyroid hormone synthesis, secretion and action     106985187 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     106985187 (BCL2)   09156 Nervous system    04725 Cholinergic synapse     106985187 (BCL2)    04722 Neurotrophin signaling pathway     106985187 (BCL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     106985187 (BCL2)    05206 MicroRNAs in cancer     106985187 (BCL2)   09162 Cancer: specific types    05210 Colorectal cancer     106985187 (BCL2)    05226 Gastric cancer     106985187 (BCL2)    05215 Prostate cancer     106985187 (BCL2)    05222 Small cell lung cancer     106985187 (BCL2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     106985187 (BCL2)    05022 Pathways of neurodegeneration - multiple diseases     106985187 (BCL2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     106985187 (BCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     106985187 (BCL2)   09171 Infectious disease: bacterial    05132 Salmonella infection     106985187 (BCL2)    05152 Tuberculosis     106985187 (BCL2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     106985187 (BCL2)    05161 Hepatitis B     106985187 (BCL2)    05162 Measles     106985187 (BCL2)    05168 Herpes simplex virus 1 infection     106985187 (BCL2)    05169 Epstein-Barr virus infection     106985187 (BCL2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     106985187 (BCL2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     106985187 (BCL2)    01524 Platinum drug resistance     106985187 (BCL2)    01522 Endocrine resistance     106985187 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:aju01009]     106985187 (BCL2) Protein phosphatases and associated proteins [BR:aju01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      106985187 (BCL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  106985187 NCBI-ProteinID:  XP_026924932 UniProt:  A0A6J2A563 LinkDB All DBs Position Unknown AA seq 237 aa AA seqDB search MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPA RTSPPPPPVAPAAAAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLT PFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLN RHLHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK NT seq 714 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgctgggagaacagggtatgataaccgggagatagtcatgaagtacatccac tataagctgtcgcagaggggctacgagtgggatgccggggacgcgggcgccgcgcccccg ggggccgcccccgcgccgggcatcttctcctcccagcccgggcgcacccctgcgcccgcc aggacctccccgccgccgcccccggtcgcccccgccgccgccgccgccgccgccgccgcg ggccctgcgctcagccccgtgccacctgtggtccacctgaccctgcgccaggccggcgat gacttctcccgtcgctaccgccgcgacttcgcggagatgtccagccagctgcacctgaca ccctttaccgcaaggggacgctttgccacggtggtggaggagctcttcagggatggagtg aactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtc aaccgagagatgtcgcccctggtggacaacatcgccctgtggatgactgagtacctgaac cggcacctgcacacctggatccaagacaacggaggctgggatgcctttgtggaactgtac ggccccagcatgcagcctctgtttgatttctcctggctgtccctgaaggccctgctcagt ctggccctggtgggggcttgcatcaccctgggtgcctatctgggccacaagtga

DBGET integrated database retrieval system