KEGG   Acinonyx jubatus (cheetah): 106985200
Entry
106985200         CDS       T04657                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04010  MAPK signaling pathway
aju04064  NF-kappa B signaling pathway
aju04068  FoxO signaling pathway
aju04110  Cell cycle
aju04115  p53 signaling pathway
aju04210  Apoptosis
aju04218  Cellular senescence
aju05169  Epstein-Barr virus infection
aju05200  Pathways in cancer
aju05202  Transcriptional misregulation in cancer
aju05210  Colorectal cancer
aju05212  Pancreatic cancer
aju05213  Endometrial cancer
aju05214  Glioma
aju05216  Thyroid cancer
aju05217  Basal cell carcinoma
aju05218  Melanoma
aju05220  Chronic myeloid leukemia
aju05222  Small cell lung cancer
aju05223  Non-small cell lung cancer
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106985200 (GADD45A)
   04064 NF-kappa B signaling pathway
    106985200 (GADD45A)
   04068 FoxO signaling pathway
    106985200 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106985200 (GADD45A)
   04210 Apoptosis
    106985200 (GADD45A)
   04115 p53 signaling pathway
    106985200 (GADD45A)
   04218 Cellular senescence
    106985200 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106985200 (GADD45A)
   05202 Transcriptional misregulation in cancer
    106985200 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106985200 (GADD45A)
   05212 Pancreatic cancer
    106985200 (GADD45A)
   05225 Hepatocellular carcinoma
    106985200 (GADD45A)
   05226 Gastric cancer
    106985200 (GADD45A)
   05214 Glioma
    106985200 (GADD45A)
   05216 Thyroid cancer
    106985200 (GADD45A)
   05220 Chronic myeloid leukemia
    106985200 (GADD45A)
   05217 Basal cell carcinoma
    106985200 (GADD45A)
   05218 Melanoma
    106985200 (GADD45A)
   05213 Endometrial cancer
    106985200 (GADD45A)
   05224 Breast cancer
    106985200 (GADD45A)
   05222 Small cell lung cancer
    106985200 (GADD45A)
   05223 Non-small cell lung cancer
    106985200 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    106985200 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aju03036]
    106985200 (GADD45A)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     106985200 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     106985200 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 106985200
NCBI-ProteinID: XP_026914705
UniProt: A0A6J1ZEE1
LinkDB
Position
Unknown
AA seq 165 aa
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDASPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcagaagaccgaaaggatggataaggtgggg
gatgccctcgaggaagtgctcagcaaagccctgagtcagcgcaccatcaccgtcggggtg
tacgaggcggccaagctgctcaacgtcgacccggataacgtggtgctgtgcctgctggcg
gcggacgaggacgacgacagggatgtggctctgcagatccacttcaccctgatccaggcg
ttctgctgcgagaacgacatcaacatcctgcgcgtcagcaacccgggccgactggctgag
ctcctgctcctggagaccgacgcaagcccagcagcgagcgagggcgccgagcagcccccg
gacctgcactgcgtcctggtgacgaatccacattcatcgcagtggaaggatcctgcctta
agtcaacttatttgtttttgccgggaaagtcgctacatggatcagtgggttccagtgatt
aatctccccgaacggtga

KEGG   Acinonyx jubatus (cheetah): 106989693
Entry
106989693         CDS       T04657                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04010  MAPK signaling pathway
aju04064  NF-kappa B signaling pathway
aju04068  FoxO signaling pathway
aju04110  Cell cycle
aju04115  p53 signaling pathway
aju04210  Apoptosis
aju04218  Cellular senescence
aju05169  Epstein-Barr virus infection
aju05200  Pathways in cancer
aju05202  Transcriptional misregulation in cancer
aju05210  Colorectal cancer
aju05212  Pancreatic cancer
aju05213  Endometrial cancer
aju05214  Glioma
aju05216  Thyroid cancer
aju05217  Basal cell carcinoma
aju05218  Melanoma
aju05220  Chronic myeloid leukemia
aju05222  Small cell lung cancer
aju05223  Non-small cell lung cancer
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106989693 (GADD45B)
   04064 NF-kappa B signaling pathway
    106989693 (GADD45B)
   04068 FoxO signaling pathway
    106989693 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106989693 (GADD45B)
   04210 Apoptosis
    106989693 (GADD45B)
   04115 p53 signaling pathway
    106989693 (GADD45B)
   04218 Cellular senescence
    106989693 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106989693 (GADD45B)
   05202 Transcriptional misregulation in cancer
    106989693 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106989693 (GADD45B)
   05212 Pancreatic cancer
    106989693 (GADD45B)
   05225 Hepatocellular carcinoma
    106989693 (GADD45B)
   05226 Gastric cancer
    106989693 (GADD45B)
   05214 Glioma
    106989693 (GADD45B)
   05216 Thyroid cancer
    106989693 (GADD45B)
   05220 Chronic myeloid leukemia
    106989693 (GADD45B)
   05217 Basal cell carcinoma
    106989693 (GADD45B)
   05218 Melanoma
    106989693 (GADD45B)
   05213 Endometrial cancer
    106989693 (GADD45B)
   05224 Breast cancer
    106989693 (GADD45B)
   05222 Small cell lung cancer
    106989693 (GADD45B)
   05223 Non-small cell lung cancer
    106989693 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    106989693 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aju03036]
    106989693 (GADD45B)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     106989693 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     106989693 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 106989693
NCBI-ProteinID: XP_026905038
UniProt: A0A6J1YJX9
LinkDB
Position
Unknown
AA seq 160 aa
MTLEELVACDNAAQKMQTVSAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCL
LVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacgctggaagagctcgtggcatgcgacaacgcggcgcagaagatgcagaccgtgagc
gccgcggtggaggagctgctggtggccgcgcagcgccaggaccgcctcaccgtgggggtg
tacgagtcagccaagttgatgaatgtggaccctgacagcgtggtcctgtgccttctggcc
atcgatgaggaggaggaggatgacatcgccctgcagatacacttcacgctcatccagtcc
ttttgctgcgacaacgacatcaatatcgtccgggtgtcgggcatgcagcgcctggcgcag
ctgctgggcgagcccgcggagacccagggcaccaccgaggcccgagacctgcactgcctc
ctggtcacgaatcctcacacagatgcctggaaaagtcacggcctggtcgaggtagccagt
tactgcgaagagagccgaggaaacaaccagtgggtcccctacatctccctccaggagcgt
tga

KEGG   Acinonyx jubatus (cheetah): 113594268
Entry
113594268         CDS       T04657                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04010  MAPK signaling pathway
aju04064  NF-kappa B signaling pathway
aju04068  FoxO signaling pathway
aju04110  Cell cycle
aju04115  p53 signaling pathway
aju04210  Apoptosis
aju04218  Cellular senescence
aju05169  Epstein-Barr virus infection
aju05200  Pathways in cancer
aju05202  Transcriptional misregulation in cancer
aju05210  Colorectal cancer
aju05212  Pancreatic cancer
aju05213  Endometrial cancer
aju05214  Glioma
aju05216  Thyroid cancer
aju05217  Basal cell carcinoma
aju05218  Melanoma
aju05220  Chronic myeloid leukemia
aju05222  Small cell lung cancer
aju05223  Non-small cell lung cancer
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113594268 (GADD45G)
   04064 NF-kappa B signaling pathway
    113594268 (GADD45G)
   04068 FoxO signaling pathway
    113594268 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113594268 (GADD45G)
   04210 Apoptosis
    113594268 (GADD45G)
   04115 p53 signaling pathway
    113594268 (GADD45G)
   04218 Cellular senescence
    113594268 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113594268 (GADD45G)
   05202 Transcriptional misregulation in cancer
    113594268 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    113594268 (GADD45G)
   05212 Pancreatic cancer
    113594268 (GADD45G)
   05225 Hepatocellular carcinoma
    113594268 (GADD45G)
   05226 Gastric cancer
    113594268 (GADD45G)
   05214 Glioma
    113594268 (GADD45G)
   05216 Thyroid cancer
    113594268 (GADD45G)
   05220 Chronic myeloid leukemia
    113594268 (GADD45G)
   05217 Basal cell carcinoma
    113594268 (GADD45G)
   05218 Melanoma
    113594268 (GADD45G)
   05213 Endometrial cancer
    113594268 (GADD45G)
   05224 Breast cancer
    113594268 (GADD45G)
   05222 Small cell lung cancer
    113594268 (GADD45G)
   05223 Non-small cell lung cancer
    113594268 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    113594268 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aju03036]
    113594268 (GADD45G)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     113594268 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     113594268 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 113594268
NCBI-ProteinID: XP_026897000
UniProt: A0A6J1XXK7
LinkDB
Position
Unknown
AA seq 159 aa
MTLEEIRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGDEEAASGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRRVNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaggaaatccgcggccaagacacggttcccgaaagcaccgccaggatgcag
ggcgccgggaaagcgctgcacgagctgctgctgtcggcacagcgccagggctgtctcacc
gccggcgtctatgagtccgccaaagtcctgaacgtggaccccgacaacgtgaccttctgc
gtgctggccgccgacgaggaggacgagggcgacatcgcgctgcagatccactttacgctg
atccaggcgttctgctgcgagaacgacatcgacatcgtgcgcgtgggcgacgtacagcgg
ctggcggcgatcgtgggcgctggcgacgaggaggccgcgtcgggagacctacactgcatc
ctcatttcgaaccccaatgaggacgcgtggaaggaccccgccttggagaagctcagcctg
ttctgcgaggagagccgcagggtcaacgactgggtgcccagtatcaccctccccgagtga

DBGET integrated database retrieval system