KEGG   Acinonyx jubatus (cheetah): 106985461
Entry
106985461         CDS       T04657                                 

Gene name
CHEK2
Definition
(RefSeq) serine/threonine-protein kinase Chk2 isoform X3
  KO
K06641  serine/threonine-protein kinase CHEK2 [EC:2.7.11.1]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04110  Cell cycle
aju04115  p53 signaling pathway
aju04218  Cellular senescence
aju05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:aju00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106985461 (CHEK2)
   04115 p53 signaling pathway
    106985461 (CHEK2)
   04218 Cellular senescence
    106985461 (CHEK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106985461 (CHEK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aju01001]
    106985461 (CHEK2)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aju03400]
    106985461 (CHEK2)
Enzymes [BR:aju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106985461 (CHEK2)
Protein kinases [BR:aju01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   106985461 (CHEK2)
DNA repair and recombination proteins [BR:aju03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    106985461 (CHEK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr FHA Kinase-like Kdo Pkinase_fungal RIO1 YrbL-PhoP_reg Haspin_kinase LEA_6 APH
Other DBs
NCBI-GeneID: 106985461
NCBI-ProteinID: XP_014939141
UniProt: A0A6J0A6H1
LinkDB
Position
Unknown
AA seq 552 aa
MSRETDVEGQPPHGSGACSQSQGSFSQSQGISSQSQGISSQTHGSSSHSQGTSSSSTNTA
PTSSQSSHSSSGTLSSLDTVSTQELCSIPEDQEPEEPVPAPWARLWALQDGFTNLECVND
SYWFGRDRSCEYCFDEPLLKRTDKYRTYSKKHFRIFREMGPKNSYIAYIEDHSGNGTFVN
RELVGKGRRLPLSNNSEIALSVWSNKVFVFFDLTVDDQSVYPKELRDEYIMSKTLGSGAC
GEVKLAFERKTCKKVAVKIISKRKFAVGSEREADPALNVETEIEILKKLNHPCIIKIKDF
FEAEDYYIVLELMEGGELFDRVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPE
NVLLSSQKEDCLIKITDFGQSKILGETSLMRTLCGTPTYLAPEVLNSFGTAGYNRAVDCW
SLGVILFICLSGYPPFSEHKTQVSLKDQITSGKFNFIPEVWAEVSEKALDLVKKLLIVDP
KVRFTTEEALRHPWLQDEDMKRKFQNLLFEENKSTTVPQVPAQPSTSRKRLLEGEAEDAD
TTKRLAVCAAVS
NT seq 1659 nt   +upstreamnt  +downstreamnt
atgtctcgggagacggatgtggagggtcagccgccccatggcagtggtgcctgttcacag
tcccaaggcagcttctcgcagtctcaaggcatctcctcccagtctcaaggcatctcctcc
cagacacatggctcctcctcacactcgcagggcacgtccagctcttccaccaacacagca
cccacatccagccagtcctctcattccagctcggggactctgagctccttagacacggtg
tccacccaggaactctgttcgattcccgaggaccaagaaccggaggagcctgtccctgcc
ccttgggctcgattgtgggctcttcaggatggattcaccaatcttgagtgtgttaatgac
agctactggtttgggagagataggagctgcgaatactgctttgatgagccactgctgaaa
agaacggataaataccggacttacagcaagaaacactttcggattttcagagaaatgggt
cccaaaaactcttacatcgcatacatagaagatcacagtgggaatggaacctttgtaaat
agagagcttgtagggaaaggaagacgccttcctttgagtaacaattctgaaattgcactt
tcagtgtggagtaataaagtttttgtattttttgacctgactgtagatgatcagtcagtt
tatcctaaggaattaagagacgaatacatcatgtcaaaaactctcggaagcggtgcctgt
ggtgaggtgaagctagcttttgagaggaaaacatgtaagaaagtagccgtaaaaatcatc
agcaaaaggaagtttgctgttggctctgagagagaggcagatccggctctcaatgttgaa
acagaaatagaaattttgaaaaaactaaatcatccttgtatcatcaagattaaagacttt
tttgaggctgaagattattatattgttttggaattgatggaaggaggagagctgtttgac
agggtggtggggaataaacgcctgaaagaagctacgtgcaagctctatttttaccagatg
ctcctggccgtacagtaccttcatgaaaacggcattatacatcgggacttaaagccagag
aatgttttactctcatcccaaaaagaggactgtcttataaagattactgattttgggcag
tctaagattttgggggagacctctctcatgagaaccttatgtggtacccctacctacctg
gctcctgaggttcttaattcctttgggactgctggatataaccgagctgtggattgctgg
agtttaggagttattctttttatttgccttagtgggtatccacctttctctgagcataag
actcaagtgtccttgaaggatcagatcaccagtggaaaattcaacttcattcccgaagtc
tgggcagaggtctcagagaaggctctggaccttgtcaagaagttgctaatagtggatcca
aaggtgcgttttacaacagaggaggctttaagacacccatggcttcaggatgaggacatg
aagagaaaatttcagaatttgctttttgaagaaaataagtcgacgactgtaccccaagtc
ccagcccagccttccacgagtcgaaagcgacttcttgaaggggaagcagaggacgctgac
accacaaagcgtctggctgtgtgtgctgctgtgtcgtga

DBGET integrated database retrieval system