Acinonyx jubatus (cheetah): 106986010 Help Entry 106986010         CDS       T04657                                  Gene name BCL2L1 Definition (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism aju  Acinonyx jubatus (cheetah) Pathway aju01521   EGFR tyrosine kinase inhibitor resistance aju01524   Platinum drug resistance aju04014   Ras signaling pathway aju04064   NF-kappa B signaling pathway aju04115   p53 signaling pathway aju04137   Mitophagy - animal aju04140   Autophagy - animal aju04151   PI3K-Akt signaling pathway aju04210   Apoptosis aju04215   Apoptosis - multiple species aju04621   NOD-like receptor signaling pathway aju04630   JAK-STAT signaling pathway aju05012   Parkinson disease aju05014   Amyotrophic lateral sclerosis aju05022   Pathways of neurodegeneration - multiple diseases aju05145   Toxoplasmosis aju05162   Measles aju05166   Human T-cell leukemia virus 1 infection aju05168   Herpes simplex virus 1 infection aju05170   Human immunodeficiency virus 1 infection aju05200   Pathways in cancer aju05202   Transcriptional misregulation in cancer aju05212   Pancreatic cancer aju05220   Chronic myeloid leukemia aju05222   Small cell lung cancer aju05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:aju00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     106986010 (BCL2L1)    04630 JAK-STAT signaling pathway     106986010 (BCL2L1)    04064 NF-kappa B signaling pathway     106986010 (BCL2L1)    04151 PI3K-Akt signaling pathway     106986010 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106986010 (BCL2L1)    04137 Mitophagy - animal     106986010 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     106986010 (BCL2L1)    04215 Apoptosis - multiple species     106986010 (BCL2L1)    04115 p53 signaling pathway     106986010 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     106986010 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     106986010 (BCL2L1)    05202 Transcriptional misregulation in cancer     106986010 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     106986010 (BCL2L1)    05225 Hepatocellular carcinoma     106986010 (BCL2L1)    05220 Chronic myeloid leukemia     106986010 (BCL2L1)    05222 Small cell lung cancer     106986010 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     106986010 (BCL2L1)    05014 Amyotrophic lateral sclerosis     106986010 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     106986010 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     106986010 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     106986010 (BCL2L1)    05162 Measles     106986010 (BCL2L1)    05168 Herpes simplex virus 1 infection     106986010 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     106986010 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     106986010 (BCL2L1)    01524 Platinum drug resistance     106986010 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:aju01009]     106986010 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aju03036]     106986010 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:aju02000]     106986010 (BCL2L1) Protein phosphatases and associated proteins [BR:aju01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      106986010 (BCL2L1) Chromosome and associated proteins [BR:aju03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Other centriole associated proteins     106986010 (BCL2L1) Transporters [BR:aju02000]  Other transporters   Pores ion channels [TC:1]    106986010 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  106986010 NCBI-ProteinID:  XP_014939673 UniProt:  A0A6J0A788 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggcg gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtgaagcaggcgctgagggaggccggggatgagtttgaactgagg taccggcgggcattcagcgacctgacatcccagcttcacatcaccccagggacagcatat cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgcagcg gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system