KEGG   Acinonyx jubatus (cheetah): 106986010
Entry
106986010         CDS       T04657                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01521  EGFR tyrosine kinase inhibitor resistance
aju01524  Platinum drug resistance
aju04014  Ras signaling pathway
aju04064  NF-kappa B signaling pathway
aju04115  p53 signaling pathway
aju04137  Mitophagy - animal
aju04140  Autophagy - animal
aju04151  PI3K-Akt signaling pathway
aju04210  Apoptosis
aju04215  Apoptosis - multiple species
aju04621  NOD-like receptor signaling pathway
aju04630  JAK-STAT signaling pathway
aju05012  Parkinson disease
aju05014  Amyotrophic lateral sclerosis
aju05022  Pathways of neurodegeneration - multiple diseases
aju05145  Toxoplasmosis
aju05162  Measles
aju05166  Human T-cell leukemia virus 1 infection
aju05168  Herpes simplex virus 1 infection
aju05170  Human immunodeficiency virus 1 infection
aju05200  Pathways in cancer
aju05202  Transcriptional misregulation in cancer
aju05212  Pancreatic cancer
aju05220  Chronic myeloid leukemia
aju05222  Small cell lung cancer
aju05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    106986010 (BCL2L1)
   04630 JAK-STAT signaling pathway
    106986010 (BCL2L1)
   04064 NF-kappa B signaling pathway
    106986010 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    106986010 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106986010 (BCL2L1)
   04137 Mitophagy - animal
    106986010 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    106986010 (BCL2L1)
   04215 Apoptosis - multiple species
    106986010 (BCL2L1)
   04115 p53 signaling pathway
    106986010 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    106986010 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106986010 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    106986010 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    106986010 (BCL2L1)
   05225 Hepatocellular carcinoma
    106986010 (BCL2L1)
   05220 Chronic myeloid leukemia
    106986010 (BCL2L1)
   05222 Small cell lung cancer
    106986010 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    106986010 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    106986010 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    106986010 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106986010 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    106986010 (BCL2L1)
   05162 Measles
    106986010 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    106986010 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    106986010 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106986010 (BCL2L1)
   01524 Platinum drug resistance
    106986010 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aju01009]
    106986010 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aju03036]
    106986010 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aju02000]
    106986010 (BCL2L1)
Protein phosphatases and associated proteins [BR:aju01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106986010 (BCL2L1)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106986010 (BCL2L1)
Transporters [BR:aju02000]
 Other transporters
  Pores ion channels [TC:1]
   106986010 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 106986010
NCBI-ProteinID: XP_014939673
UniProt: A0A6J0A788
LinkDB
Position
Unknown
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg
actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggcg
gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg
atccccatggcagcggtgaagcaggcgctgagggaggccggggatgagtttgaactgagg
taccggcgggcattcagcgacctgacatcccagcttcacatcaccccagggacagcatat
cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct
tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgcagcg
gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg
gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system