KEGG   Acinonyx jubatus (cheetah): 106986545Help
Entry
106986545         CDS       T04657                                 

Definition
(RefSeq) anionic trypsin isoform X2
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04080  Neuroactive ligand-receptor interaction
aju04972  Pancreatic secretion
aju04974  Protein digestion and absorption
aju05164  Influenza A
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106986545
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    106986545
   04974 Protein digestion and absorption
    106986545
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    106986545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aju01002]
    106986545
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aju04147]
    106986545
Enzymes [BR:aju01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     106986545
Peptidases [BR:aju01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   106986545
Exosome [BR:aju04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106986545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 106986545
NCBI-ProteinID: XP_014940211
LinkDB All DBs
Position
Unknown
AA seq 247 aa AA seqDB search
MTPLLILAFVGAAVAFPTDDDDKIVGGFTCEENSIPYQVSLNSGYHFCGGSLISDQWVVS
AAHCYKSRIQVRLGEHNIEVLEGDEQFINSAKVIRHPRFNSWTLDYDIMLIKLSSPAALT
ARVSTISLPSACAPAGTQCLISGWGNTLSSGTNYPELLQCLDAPLLSQDQCKAAYPGQIT
ENMVCAGFLEGGKDSCQGDSGGPVVCGGELQGIVSWGYGCAQKNKPGVYTKVCNFTDWIK
EMIAANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgactccactcctgatccttgctttcgtgggagctgctgttgctttccccactgacgac
gatgacaagatcgttgggggctttacctgtgaggagaactccatcccctaccaggtgtcc
ctgaactcgggctaccacttctgcggcggctccctcatcagtgaccagtgggtggtgtct
gcggctcactgctacaagtctcgcatccaagtgaggctcggagagcacaacatcgaagtc
ctggagggggatgagcagttcatcaactcggccaaggtcatccgccaccccagatttaac
agctggaccctggactatgacatcatgcttatcaagctctcctcacctgcagccctcact
gcccgggtgtccaccatatcgctgccctccgcctgtgcccccgccggcacccagtgcctc
atctccggctggggcaacaccctgagctctggcaccaactaccccgagctgctacagtgc
ctggacgccccgctgctgagccaggaccagtgtaaagccgcctaccccgggcagatcacg
gagaacatggtttgcgctggcttcctcgagggaggcaaggactcctgccagggtgactct
ggtggccctgtggtctgcggaggagagctccagggcatcgtctcctggggctatggctgt
gcccagaagaacaagcctggcgtctacaccaaggtgtgcaactttacagactggattaag
gagatgatagctgccaacagctaa

DBGET integrated database retrieval system