KEGG   Acinonyx jubatus (cheetah): 106986916
Entry
106986916         CDS       T04657                                 

Gene name
CDK2
Definition
(RefSeq) cyclin-dependent kinase 2 isoform X1
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04068  FoxO signaling pathway
aju04110  Cell cycle
aju04114  Oocyte meiosis
aju04115  p53 signaling pathway
aju04151  PI3K-Akt signaling pathway
aju04218  Cellular senescence
aju04914  Progesterone-mediated oocyte maturation
aju04934  Cushing syndrome
aju05160  Hepatitis C
aju05161  Hepatitis B
aju05162  Measles
aju05165  Human papillomavirus infection
aju05166  Human T-cell leukemia virus 1 infection
aju05169  Epstein-Barr virus infection
aju05200  Pathways in cancer
aju05203  Viral carcinogenesis
aju05215  Prostate cancer
aju05222  Small cell lung cancer
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106986916 (CDK2)
   04151 PI3K-Akt signaling pathway
    106986916 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106986916 (CDK2)
   04114 Oocyte meiosis
    106986916 (CDK2)
   04115 p53 signaling pathway
    106986916 (CDK2)
   04218 Cellular senescence
    106986916 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    106986916 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106986916 (CDK2)
   05203 Viral carcinogenesis
    106986916 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    106986916 (CDK2)
   05215 Prostate cancer
    106986916 (CDK2)
   05222 Small cell lung cancer
    106986916 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106986916 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106986916 (CDK2)
   05161 Hepatitis B
    106986916 (CDK2)
   05160 Hepatitis C
    106986916 (CDK2)
   05162 Measles
    106986916 (CDK2)
   05169 Epstein-Barr virus infection
    106986916 (CDK2)
   05165 Human papillomavirus infection
    106986916 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aju01001]
    106986916 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aju03032]
    106986916 (CDK2)
   03036 Chromosome and associated proteins [BR:aju03036]
    106986916 (CDK2)
Enzymes [BR:aju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     106986916 (CDK2)
Protein kinases [BR:aju01001]
 Serine/threonine kinases: CMGC group
  CDK family
   106986916 (CDK2)
DNA replication proteins [BR:aju03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    106986916 (CDK2)
Chromosome and associated proteins [BR:aju03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106986916 (CDK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 106986916
NCBI-ProteinID: XP_014940619
UniProt: A0A6J0A5R3
LinkDB
Position
Unknown
AA seq 346 aa
MENFQKVEKIGEGTYGVVYKAKNKVTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMHLVCTQHHARCCGEHRRNGRHSLCPLCSYLEVAASQGGGMTAVS
TPHPVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVV
PPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagaacttccaaaaagtggaaaagatcggagagggcacgtacggagttgtgtacaaa
gcgaaaaacaaggtgacgggagaagtggtggcgcttaaaaaaatccgcctggacactgag
acagagggtgtacccagtactgctatacgagagatttctctgcttaaggagcttaaccac
cctaacattgtcaagctgctggatgtcatccacacagaaaacaaactctacctagttttt
gaatttctgcaccaggatctgaagaaattcatggatgcctctgctttgactggcattcct
cttcccctcatcaagagctatctgttccagttgctccagggcctagccttctgccattct
catcgggttctgcaccgagacctcaaacctcagaatctgcttatcaacgcagagggggcc
atcaagctagcagactttggactagccagagcctttggagtacctgttcgtacttacacc
catgaggtggtgaccctgtggtaccgagcacctgaaatccttctgggctgcaagtactac
tccacagctgtagatatctggagcctgggctgcatctttgctgagatgcacctagtgtgt
acccagcaccatgctaggtgctgtggggaacacagaagaaatggaagacacagtctctgc
ccgctgtgctcctatctagaagtggctgcatcacaaggaggggggatgaccgcagtgtct
accccacaccccgtgacccgccgagccctatttcctggagattccgaaatcgaccaactc
ttccggatcttccggactctggggaccccagatgaagtggtttggccaggagttacttct
atgcctgattataagccgagtttccccaagtgggcccggcaagattttagcaaagttgtt
cctcccttggatgaagatggacggagcttgctgtcgcaaatgctgcactacgaccccaac
aagcggatttcggcaaaggcagctctggctcaccctttcttccaggatgtgaccaagcca
gtgccccaccttcgactctga

DBGET integrated database retrieval system