KEGG   Acinonyx jubatus (cheetah): 106986967Help
Entry
106986967         CDS       T04657                                 

Gene name
FADS2
Definition
(RefSeq) fatty acid desaturase 2 isoform X1
  KO
K10226  acyl-CoA 6-desaturase (Delta-6 desaturase) [EC:1.14.19.3]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00592  alpha-Linolenic acid metabolism
aju01040  Biosynthesis of unsaturated fatty acids
aju01100  Metabolic pathways
aju01212  Fatty acid metabolism
aju03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    106986967 (FADS2)
   01040 Biosynthesis of unsaturated fatty acids
    106986967 (FADS2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    106986967 (FADS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aju01004]
    106986967 (FADS2)
Enzymes [BR:aju01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     106986967 (FADS2)
Lipid biosynthesis proteins [BR:aju01004]
 Desaturase
  Front-end
   106986967 (FADS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase Cyt-b5 CHDNT
Motif
Other DBs
NCBI-GeneID: 106986967
NCBI-ProteinID: XP_026901741
LinkDB All DBs
Position
Unknown
AA seq 444 aa AA seqDB search
MGKGGNQGGGATEREAPMPTFSWEEIQKHNLRTDKWLVIDRKVYNITKWSSRHPGGQRVI
GHYAGEDATDAFRAFHRDLDFVHKFMKPLLIGELAPEEPGQDHGKNSQITEDFRALRKTA
EDMNLFKSNHLFFLLLLAHIIAMESIAWFTIFYFGNGWIPTVITAFVLATSQAQAGWLQH
DYGHLSVYKKSTWNHFVHKFIIGHLKGASANWWNHRHFQHHAKPNIFHKDPDVNMLHVFV
LGEWQPVEYGKKKLKYLPYNHQHEYFFLIGPPLLIPVYFQYQIIMTMIARRDWVDLAWAI
SYYARFLLTYSPFYGILGAVLFLNFIRFLESHWFVWVTQMNHIVMEIDCEPYRDWFSSQL
AATCNVEQSLFNDWFSGHLNFQIEHHLFPTMPRHNFHKVAPLVKSLCAKHGIKYQEKPLL
RALQDIIRSLKKSGQLWLDAYLHK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaggggggaaccagggcgggggggccaccgagcgcgaggcgccgatgcccacc
ttcagctgggaggagattcagaagcacaacctgcgcacggacaagtggctcgtcatcgac
cgcaaggtctacaacatcaccaaatggtccagccggcacccggggggccagcgggtcatc
gggcactacgcgggggaagatgcgacggatgccttccgagccttccaccgtgaccttgat
tttgtgcacaagttcatgaagcctctgctgatcggagagctggccccggaagagcctggc
caggaccatggcaagaattcccagatcacagaggacttccgggccctgaggaagaccgct
gaggatatgaacctgtttaagagcaaccacctgttcttcctcctcctcctggcccacatc
attgccatggagagcatcgcctggttcaccatcttttactttggcaatggctggattcca
accgtcatcacggcctttgtccttgctacctctcaggcccaagctgggtggctgcaacac
gattatggccacctgtcagtctacaagaagtccacatggaaccacttcgtccacaagttc
atcattggccacttaaagggtgcctccgccaactggtggaaccatcgtcacttccagcat
cacgccaagcccaacatcttccacaaggatccggatgtgaacatgctgcatgtgtttgtc
ctgggcgaatggcagcccgttgagtacggcaagaagaagctgaaatacctaccttacaat
caccagcacgagtacttcttcctgatcgggccaccactgctcatccctgtgtacttccag
taccagatcatcatgaccatgatcgcacgcagagactgggtggacttggcctgggccatc
agctattatgctcgcttcttgctcacctacagccctttctatggcatcctgggggccgtc
cttttcctcaacttcatcaggttcctggagagccactggtttgtgtgggtcacgcagatg
aaccacatcgtcatggagatcgactgcgagccttaccgtgactggttcagcagccagctg
gctgccacctgcaacgtggaacagtccttgttcaatgactggttcagcgggcacctcaac
ttccagatcgagcaccacctcttccccaccatgccccggcacaacttccacaaggtggcc
ccgctggtgaagtctctgtgtgccaagcacggcattaagtaccaggagaagccactgctg
agggccctgcaggacatcatcaggtccctgaagaagtccgggcagctgtggctggacgcg
tacctccacaaatga

DBGET integrated database retrieval system