KEGG   Acinonyx jubatus (cheetah): 106987785Help
Entry
106987785         CDS       T04657                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1 isoform X2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00250  Alanine, aspartate and glutamate metabolism
aju00410  beta-Alanine metabolism
aju00430  Taurine and hypotaurine metabolism
aju00650  Butanoate metabolism
aju01100  Metabolic pathways
aju04727  GABAergic synapse
aju04940  Type I diabetes mellitus
Module
aju_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    106987785 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    106987785 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106987785 (GAD1)
   00430 Taurine and hypotaurine metabolism
    106987785 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    106987785 (GAD1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    106987785 (GAD1)
Enzymes [BR:aju01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     106987785 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 SepSecS OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 106987785
NCBI-ProteinID: XP_014941590
LinkDB All DBs
Position
Unknown
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDRDGRFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARYKFFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADLEAKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGIPDSPERREKLHRVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgaccccttcttcgtccgcaacctcctcgaatgcgggagcggaccccaat
actaccaacctgcgccccacaacatatgacacctggtgcggcgtggcccatggatgcacc
agaaaactggggctcaagatctgcggcttcctgcaaaggaccaacagcctggaagagaag
agccggcttgtgagcgccttcaaggagaggcagtcctccaaaaacctgctttcctgtgaa
aacagcgacagggatggacgcttccggcgcacggagacggacttctccaacctgtttgct
cgagatctgcttccggctaagaacggggaagagcaaactgtgcagttcctactggaggtg
gtagacatactcctcaactatgtccgcaagacatttgatcgctccaccaaggtgctggac
ttccatcacccacaccagctgctggaaggcatggagggcttcaacttggagctctctgac
caccctgagtccctggaacagatcttggttgactgcagagacaccctgaagtatggggtt
cgtacaggtcaccctcgatttttcaaccagctctccactggactggatatcattggttta
gctggcgaatggctgacatcaactgccaataccaatatgtttacatatgaaattgcacca
gtatttgtcctcatggagcaaataacacttaagaagatgagggagatagttggatggtca
agtaaagacggtgatgggatattttctcctgggggagccatctccaacatgtacagcatc
atggccgctcgttacaagttcttcccggaagttaagacaaagggcatggcagctgttccc
aaactggtcctcttcacctcagaacatagtcactattccataaagaaggctggagctgca
cttggctttggaaccgacaatgtgattttgataaagtgcaatgaaagggggaagataatt
ccagctgatttagaggcaaaaattcttgaagccaagcaaaagggatacgttcccctttat
gtcaatgcaactgctggtacaactgtttatggagctttcgatccgatacaggagattgca
gatatatgtgagaaatacaacctgtggctacatgtcgacgctgcctggggcggtgggctg
cttatgtccaggaagcaccgccacaaactcagtggcatagaaagggccaactcagtcacc
tggaaccctcacaagatgatgggcgtgctgttgcagtgctcggccatcctcgtcaaggaa
aagggtatactccaaggatgcaaccagatgtgtgcaggataccttttccagccagacaaa
cagtacgatgtctcctatgacactggggacaaggcaatccagtgtggccgccacgtggac
attttcaagttctggctaatgtggaaagcaaagggcacagtgggatttgaaaatcagatc
aacaaatgcttggagctggctgaatacctctatgccaagattaaaaacagagaagaattt
gagatggttttcgatggtgagcctgagcatacaaatgtctgtttctggtatattccacaa
agcctcaggggcattccagatagccctgaacgacgggaaaaactacacagggtggccccc
aaaatcaaagccctgatgatggagtctggcacgaccatggttggctaccagccccagggg
gacaaggccaactttttccggatggtcatctcgaacccagctgctacacagtccgatatt
gacttcctcatcgaggagatagaaagactgggccaggatctgtaa

DBGET integrated database retrieval system