KEGG   Acinonyx jubatus (cheetah): 106987995
Entry
106987995         CDS       T04657                                 

Gene name
CASP8
Definition
(RefSeq) caspase-8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01524  Platinum drug resistance
aju04115  p53 signaling pathway
aju04210  Apoptosis
aju04215  Apoptosis - multiple species
aju04217  Necroptosis
aju04620  Toll-like receptor signaling pathway
aju04621  NOD-like receptor signaling pathway
aju04622  RIG-I-like receptor signaling pathway
aju04625  C-type lectin receptor signaling pathway
aju04657  IL-17 signaling pathway
aju04668  TNF signaling pathway
aju04932  Non-alcoholic fatty liver disease
aju05010  Alzheimer disease
aju05016  Huntington disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05132  Salmonella infection
aju05134  Legionellosis
aju05142  Chagas disease
aju05145  Toxoplasmosis
aju05152  Tuberculosis
aju05160  Hepatitis C
aju05161  Hepatitis B
aju05162  Measles
aju05163  Human cytomegalovirus infection
aju05164  Influenza A
aju05165  Human papillomavirus infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05168  Herpes simplex virus 1 infection
aju05169  Epstein-Barr virus infection
aju05170  Human immunodeficiency virus 1 infection
aju05200  Pathways in cancer
aju05203  Viral carcinogenesis
aju05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    106987995 (CASP8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106987995 (CASP8)
   04215 Apoptosis - multiple species
    106987995 (CASP8)
   04217 Necroptosis
    106987995 (CASP8)
   04115 p53 signaling pathway
    106987995 (CASP8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106987995 (CASP8)
   04621 NOD-like receptor signaling pathway
    106987995 (CASP8)
   04622 RIG-I-like receptor signaling pathway
    106987995 (CASP8)
   04625 C-type lectin receptor signaling pathway
    106987995 (CASP8)
   04657 IL-17 signaling pathway
    106987995 (CASP8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106987995 (CASP8)
   05203 Viral carcinogenesis
    106987995 (CASP8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106987995 (CASP8)
   05016 Huntington disease
    106987995 (CASP8)
   05022 Pathways of neurodegeneration - multiple diseases
    106987995 (CASP8)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    106987995 (CASP8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    106987995 (CASP8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106987995 (CASP8)
   05134 Legionellosis
    106987995 (CASP8)
   05152 Tuberculosis
    106987995 (CASP8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    106987995 (CASP8)
   05161 Hepatitis B
    106987995 (CASP8)
   05160 Hepatitis C
    106987995 (CASP8)
   05164 Influenza A
    106987995 (CASP8)
   05162 Measles
    106987995 (CASP8)
   05168 Herpes simplex virus 1 infection
    106987995 (CASP8)
   05163 Human cytomegalovirus infection
    106987995 (CASP8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106987995 (CASP8)
   05169 Epstein-Barr virus infection
    106987995 (CASP8)
   05165 Human papillomavirus infection
    106987995 (CASP8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    106987995 (CASP8)
   05142 Chagas disease
    106987995 (CASP8)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    106987995 (CASP8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aju01002]
    106987995 (CASP8)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     106987995 (CASP8)
Peptidases and inhibitors [BR:aju01002]
 Cysteine peptidases
  Family C14: caspase family
   106987995 (CASP8)
SSDB
Motif
Pfam: Peptidase_C14 DED PYRIN
Other DBs
NCBI-GeneID: 106987995
NCBI-ProteinID: XP_014941844
UniProt: A0A6J1YW13
LinkDB
Position
Unknown
AA seq 479 aa
MDFSKCLYNIGEQLGSDELASLKFLSLDYIPQKKQEPIKDALMLFQRLQEKRMLEESNLS
FLKELLFRINRLDLLFNYLNTSKEAMQQELQIPGRAQIPPYRVMLFQISEDVNKLELRSF
KFLLSQEISRCKVDDDMNLLDIFIEMEKRVILGERNLDTLKRICDQINKSLLKKITDYEE
LSREGRMSLQRSPDELSNGEESLAMMALSDSLEEQDSESQTSDKVYRMKSKPRGYCLIFN
NYDFSRARKDVPKLQNIKDRNGTNFDAEALSKTFSELHFEIVNFKDSTAKTICEVLKSYQ
RMDHNNKDCFICCILSHGDKGIIYGSDGQEAPIYELTSYFTGSKCPSLAGKPKIFFIQAC
QGDNYQRGIAVETDSEQKEDYLEMDSSFQKRYIPDEADFLLGMATVNNCVSYRNPTEGTW
YIQSLCQSLRERCPRGEDILTILTEVNFEVSNKDDKKNMGKQMPQPTFTLRKKLFFPLN
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggatttcagtaaatgtctgtataatattggggaacagctgggcagtgacgagctggcc
tccctcaaattcctgagcctggactacatcccacaaaagaagcaagaacccatcaaagat
gccttgatgttattccagagactccaggaaaagagaatgttggaggaaagcaacctgtcc
ttcttgaaggagctgcttttccgaattaatagactggacctgctgttcaactacctgaac
accagcaaggaagcgatgcagcaggagcttcagataccaggcagagcccagatccctccc
tacagggtcatgctttttcagatttcagaagatgtaaacaaattggaattgaggtcgttt
aagtttcttttgagccaggagatctccagatgtaaagtggatgatgatatgaacttgctt
gatattttcatagagatggaaaagagggtcatcctaggggaaagaaatttggacactctg
aaaagaatctgtgaccaaatcaacaagagcctgctgaagaaaatcactgattatgaagaa
ttaagcagagagggaagaatgagccttcaaagaagtccagatgaattgtcaaatggggag
gaatccctggcaatgatggcattatcggactctctagaagaacaggacagtgagtcacag
acatcggacaaagtttaccgaatgaaaagcaaacctcgcggatattgtttgatctttaac
aattatgattttagcagagcacggaaggatgtgcccaaacttcagaacattaaggatagg
aatggaacaaacttcgatgcagaagctttgagtaagacctttagtgagcttcattttgag
attgtgaatttcaaagactctacagcaaagacaatctgtgaagttctgaaatcctaccaa
agaatggaccataataacaaagattgcttcatctgctgtatcctctcccatggagacaaa
ggcattatttatggctctgatgggcaggaagcccccatctatgagctgacttcttacttc
actggttcaaagtgcccttcccttgcaggcaagcccaaaatcttttttattcaggcttgt
caaggggataactaccagagaggtatagctgttgagactgactccgaacagaaggaagac
tacttagaaatggactcatcatttcagaagagatatatcccagatgaggctgattttctg
ctggggatggccactgtgaacaactgtgtttcctaccgaaaccctacggaggggacctgg
tatatccagtcactttgccagagcctaagagaaagatgtcctaggggcgaagatatcctc
accatccttactgaggtgaactttgaagtgagcaataaggatgacaagaaaaacatgggg
aaacaaatgccacaacctactttcacactgaggaaaaaactcttcttccctcttaattga

DBGET integrated database retrieval system