KEGG   Acinonyx jubatus (cheetah): 106988106Help
Entry
106988106         CDS       T04657                                 

Gene name
PLOD3
Definition
(RefSeq) procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 isoform X1
  KO
K13646  lysyl hydroxylase/galactosyltransferase/glucosyltransferase [EC:1.14.11.4 2.4.1.50 2.4.1.66]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00310  Lysine degradation
aju00514  Other types of O-glycan biosynthesis
aju01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    106988106 (PLOD3)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    106988106 (PLOD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aju01003]
    106988106 (PLOD3)
Enzymes [BR:aju01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.4  procollagen-lysine 5-dioxygenase
     106988106 (PLOD3)
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     106988106 (PLOD3)
    2.4.1.66  procollagen glucosyltransferase
     106988106 (PLOD3)
Glycosyltransferases [BR:aju01003]
 O-Glycan biosynthesis
  O-linked Gal type
   106988106 (PLOD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 106988106
NCBI-ProteinID: XP_026897834
LinkDB All DBs
Position
Unknown
AA seq 818 aa AA seqDB search
MASWGPGLRLLLGILLLLLPPPATPASDRPRGRDPVNPEKLLVITVATAKTEGYRRFLRS
AEFFNYTVRTLGLGQEWRGGDVARTVGGGQKVRWLKKEMEKYADREDMVIMFVDSYDVIL
AGSPSELLKKFVQSGSRLLFSAEGFCWPEWGLAEQYPEVGTGKRFLNSGGFIGFAPTIHR
VVRQWKYEDDDDDQLFYTRLYLDPGLREKLSLNLDHKSRIFQNLNGALDEIVLKFDRNRV
RIRNVAYDTLPVVVHGNGPTKLQLNYLGNYVPNGWTPQGGCGFCGRDRRILPGGQPPPRV
LLAVFVEQPTPFLPRFLQRLLLLDYPPDRVTLFLHNNEVYHEPHIADSWPQLQGHFSAVK
LVGPEEALTPGEARDMAMDSCRQDPECEFYFSLDADAVITNEQTLRILIEENRKVIAPML
SRHGKLWSNFWGALSPDEYYARSEDYVELVQRKRVGVWNVPYISQAYVIRGETLRTELPQ
REVFSGSDTDPDMAFCKSLRDKGIFLHLSNQQEFGRLLATSRYDTDHLHPDLWQIFDNPL
DWREQYIHENYSRALEGQGLVEQPCPDVYWFPLLSDQMCDELVEEMEHYGQWSGGRHEDS
RLAGGYENVPTVDIHMKQVGYEDQWLQLLRTYVGPMTESLFPGYHTKTRAVMNFVVRYRP
DEQPSLRPHHDSSTFTLNVALNHKGLDYEVRRWLPLLALRLHSLVPTEGLGAPASWPPHP
LPRGAAHHSGHSLHHGVLCRPLTLNHSARPALPLCLPRGAPSVEGGLSGASLPEWMFGVP
GTECVASPPPQHAALSGSSWSPPLAPPHSPQGPLGRRL
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctggggcccgggactccggctcctgctgggaatcctgctgctgctgctcccg
cctcctgcgacccctgcttccgaccgtccccggggcagagacccggtcaacccagagaag
ctgctggtgatcacggtggccacagccaagacggaaggataccggcgtttcctgcggtca
gcggagttcttcaactacacagtgcggaccctgggcctgggacaggagtggcgagggggt
gatgtggcccgaacggttggtggaggacagaaggtcaggtggctaaagaaggaaatggag
aaatatgctgaccgggaggatatggtcatcatgttcgtggacagctacgacgtgattctg
gctggcagcccctccgagctgctgaagaagttcgtccagagtgggagccgcctgctcttc
tctgccgagggcttctgctggcccgagtgggggctggcggagcagtaccctgaggtgggc
acggggaagcgcttcctcaactctggtgggttcatcggctttgcccccaccatccaccga
gtggtccgccagtggaagtacgaggatgatgatgacgaccagctgttctacacacggctc
tacctggacccagggctgagggagaaactcagcctcaatctggatcataaatcccggatc
tttcagaacctcaatggggctttggatgagatagttttaaagtttgatcggaatcgcgtg
cgtatccggaatgtggcctatgacacacttcccgtcgtggtccatgggaatggtccgact
aagctccagctgaattacctgggaaactatgtccctaatggctggactcctcagggaggc
tgtgggttctgcggccgggaccggaggatactcccgggggggcagcctcccccccgggtg
cttctggccgtgttcgtggaacagcctaccccgttcctgccccgcttcctgcagcggctc
ctgctcctggactacccccctgacagggtcaccctgttcctgcataacaacgaggtgtac
catgagccccacattgcagactcctggccccagctccagggccacttctcagctgtgaag
cttgtggggccggaggaggccctgaccccgggcgaggccagggacatggccatggacagc
tgtcggcaggaccccgagtgcgaattctacttcagcctggatgctgacgccgtcatcacc
aacgagcagaccctgcgcatcctcattgaagagaacaggaaggtgatagcgcccatgctg
tcccgccacgggaagctgtggtccaacttctggggagccctgagccccgacgagtactac
gctcggtccgaggactacgtggaactagtgcagcggaagcgagtgggcgtgtggaatgtg
ccctatatatcccaggcgtacgtgatccgcggtgagaccctgaggacagagctgccccag
agggaggtgttctcgggcagcgacaccgacccggacatggccttctgtaagagcctgcgc
gacaagggcatcttcctccacctcagcaatcagcaggaatttggtcgcctcctggccacc
tctcggtatgacacagaccatctgcaccctgacctctggcaaatctttgacaaccccctg
gactggcgggagcagtacattcacgagaactacagccgggccctggaagggcagggactc
gtggagcagccgtgtccagatgtgtactggttcccgctgctgtcagaccagatgtgcgac
gagctagtggaggaaatggagcattacggccagtggtcaggaggccggcatgaggactca
aggctggctggaggctacgagaacgtgcccactgtagacatccacatgaagcaggtgggc
tatgaggaccagtggctgcagctgctgaggacgtacgtggggcccatgacagagagcctg
ttcccaggctaccacaccaagacccgggcggtgatgaactttgtggtccgctaccggcca
gatgagcagccgtctctgcggccccatcacgactcctccaccttcactctcaacgtcgcc
ctcaaccacaagggcctggattatgaggtgaggaggtggctgccgcttcttgcgctacga
ctgcatagtctcgtccccacggaagggctgggggctcctgcatcctggccgcctcaccca
ctaccacgaggggctgcccaccactcggggcactcgctacatcatggtgtcctttgtcga
cccctgacactcaaccactctgccagacctgccctgccgctgtgccttccccggggggcc
ccctccgtggaagggggtctgtctggtgcctcgcttcctgagtggatgttcggtgtgcct
gggactgaatgtgtcgcctccccccctccccaacacgcggccctctcaggaagctcctgg
agccccccccttgcccctccccacagtccccaaggacccctggggagaaggctttga

DBGET integrated database retrieval system