KEGG   Acinonyx jubatus (cheetah): 106988114
Entry
106988114         CDS       T04657                                 

Gene name
SERPINE1
Definition
(RefSeq) plasminogen activator inhibitor 1
  KO
K03982  plasminogen activator inhibitor 1
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04066  HIF-1 signaling pathway
aju04115  p53 signaling pathway
aju04218  Cellular senescence
aju04371  Apelin signaling pathway
aju04390  Hippo signaling pathway
aju04610  Complement and coagulation cascades
aju04933  AGE-RAGE signaling pathway in diabetic complications
aju05142  Chagas disease
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    106988114 (SERPINE1)
   04371 Apelin signaling pathway
    106988114 (SERPINE1)
   04066 HIF-1 signaling pathway
    106988114 (SERPINE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106988114 (SERPINE1)
   04218 Cellular senescence
    106988114 (SERPINE1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    106988114 (SERPINE1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106988114 (SERPINE1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    106988114 (SERPINE1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aju01002]
    106988114 (SERPINE1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aju04147]
    106988114 (SERPINE1)
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    106988114 (SERPINE1)
Peptidases and inhibitors [BR:aju01002]
 Peptidase inhibitors
  Family I4: serpin family
   106988114 (SERPINE1)
Exosome [BR:aju04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106988114 (SERPINE1)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   106988114 (SERPINE1)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 106988114
NCBI-ProteinID: XP_014941999
UniProt: A0A6J0A7G5
LinkDB
Position
Unknown
AA seq 402 aa
MRMSPVFACLALGLALVFGEGSASYHRQTQAARLTTDFGVKVFQQVAWASKDRNMVFSPY
GVASVLAMLQLTTGGETRQQIQAAMQFQIDEKGMAPALRQLYKELMGPWNKDEISTADAI
FVQRDLKLVKGFMPHFFRLFRTTVKQVDFSEVDRARFIVNDWVKTHTKGMIGDLLGEGAV
NQLTRLMLVNALYFNGQWKTPFPESGTHHRLFHKSDGSTVSVPMMAQTNKFNYTEFSTPD
GHYYDILELPYHGDTLSMFIAAPYEKEVPLSALTNILDAQLISQWKGNMTRQLRLLVLPK
FSLESEVNLRRPLENLGMTDMFKPNQADFSSLSDEEALYVSQALQKVKIEVNESGTVASS
STAIIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVMEP
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgcggatgtctccagtcttcgcctgcctagccctgggcctggccctcgtctttggtgaa
gggtcggcctcctaccaccgccagactcaggcggcccgactgaccacagactttggagtg
aaggtgtttcagcaggtggcatgggcctccaaggaccgcaacatggttttctcaccttac
ggggtggcctcggtcctggccatgttgcagctgacgacaggaggagagactcggcagcag
atccaagcagccatgcagttccagattgatgagaagggcatggcccctgccctccgccag
ctgtacaaggagctcatggggccgtggaacaaggatgagatcagcacggccgatgccatc
ttcgtccagcgggatctgaagctggtcaagggcttcatgcctcacttcttcaggctcttc
cggaccacggtcaagcaagtggacttctcagaggtggatagagccaggttcatcgtcaac
gactgggtgaagacacacacgaaaggcatgattggcgacttactgggcgaaggggccgtg
aaccagctgacgcgcctgatgctggtgaatgccctctacttcaatggccagtggaagacg
cccttcccagagtcaggcacccaccaccgcctcttccacaaatctgatggcagcaccgtt
tctgtgcccatgatggctcagaccaataagttcaactacactgaattttccacccccgac
ggccattactatgacattctggaattgccctaccacggggacactctcagcatgttcatt
gctgctccctatgaaaaagaggtgcctctctctgccctcaccaacatcctggatgcccag
ctcatcagccagtggaaagggaatatgaccagacagctccgcctcctggttctgcccaag
ttctccctggaaagtgaagtcaacctccggagacccctggagaacttggggatgactgac
atgtttaagccaaaccaggcggacttctcgagtctctcagatgaagaggcactgtacgtg
tcacaggcgctgcaaaaagtcaagatcgaggtgaatgagagcggcacggtggcgtcctcc
tccacagccattattgtatcagcccgaatggcccccgaggagatcatcatggacagaccc
ttcctcttcgtggttcggcacaaccccacaggaacagtcctcttcatgggccaagtgatg
gaaccctga

DBGET integrated database retrieval system