KEGG   Acinonyx jubatus (cheetah): 106988699
Entry
106988699         CDS       T04657                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX isoform X1
  KO
K02159  apoptosis regulator BAX
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01521  EGFR tyrosine kinase inhibitor resistance
aju01522  Endocrine resistance
aju01524  Platinum drug resistance
aju04071  Sphingolipid signaling pathway
aju04115  p53 signaling pathway
aju04141  Protein processing in endoplasmic reticulum
aju04210  Apoptosis
aju04211  Longevity regulating pathway
aju04215  Apoptosis - multiple species
aju04217  Necroptosis
aju04722  Neurotrophin signaling pathway
aju04932  Non-alcoholic fatty liver disease
aju04933  AGE-RAGE signaling pathway in diabetic complications
aju05012  Parkinson disease
aju05014  Amyotrophic lateral sclerosis
aju05016  Huntington disease
aju05020  Prion disease
aju05022  Pathways of neurodegeneration - multiple diseases
aju05132  Salmonella infection
aju05152  Tuberculosis
aju05160  Hepatitis C
aju05161  Hepatitis B
aju05162  Measles
aju05163  Human cytomegalovirus infection
aju05164  Influenza A
aju05165  Human papillomavirus infection
aju05166  Human T-cell leukemia virus 1 infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05168  Herpes simplex virus 1 infection
aju05169  Epstein-Barr virus infection
aju05170  Human immunodeficiency virus 1 infection
aju05200  Pathways in cancer
aju05202  Transcriptional misregulation in cancer
aju05203  Viral carcinogenesis
aju05210  Colorectal cancer
aju05212  Pancreatic cancer
aju05213  Endometrial cancer
aju05214  Glioma
aju05216  Thyroid cancer
aju05217  Basal cell carcinoma
aju05218  Melanoma
aju05220  Chronic myeloid leukemia
aju05222  Small cell lung cancer
aju05223  Non-small cell lung cancer
aju05224  Breast cancer
aju05225  Hepatocellular carcinoma
aju05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106988699 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    106988699 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106988699 (BAX)
   04215 Apoptosis - multiple species
    106988699 (BAX)
   04217 Necroptosis
    106988699 (BAX)
   04115 p53 signaling pathway
    106988699 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    106988699 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    106988699 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106988699 (BAX)
   05202 Transcriptional misregulation in cancer
    106988699 (BAX)
   05203 Viral carcinogenesis
    106988699 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106988699 (BAX)
   05212 Pancreatic cancer
    106988699 (BAX)
   05225 Hepatocellular carcinoma
    106988699 (BAX)
   05226 Gastric cancer
    106988699 (BAX)
   05214 Glioma
    106988699 (BAX)
   05216 Thyroid cancer
    106988699 (BAX)
   05220 Chronic myeloid leukemia
    106988699 (BAX)
   05217 Basal cell carcinoma
    106988699 (BAX)
   05218 Melanoma
    106988699 (BAX)
   05213 Endometrial cancer
    106988699 (BAX)
   05224 Breast cancer
    106988699 (BAX)
   05222 Small cell lung cancer
    106988699 (BAX)
   05223 Non-small cell lung cancer
    106988699 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    106988699 (BAX)
   05014 Amyotrophic lateral sclerosis
    106988699 (BAX)
   05016 Huntington disease
    106988699 (BAX)
   05020 Prion disease
    106988699 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    106988699 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    106988699 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    106988699 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106988699 (BAX)
   05152 Tuberculosis
    106988699 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106988699 (BAX)
   05170 Human immunodeficiency virus 1 infection
    106988699 (BAX)
   05161 Hepatitis B
    106988699 (BAX)
   05160 Hepatitis C
    106988699 (BAX)
   05164 Influenza A
    106988699 (BAX)
   05162 Measles
    106988699 (BAX)
   05168 Herpes simplex virus 1 infection
    106988699 (BAX)
   05163 Human cytomegalovirus infection
    106988699 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106988699 (BAX)
   05169 Epstein-Barr virus infection
    106988699 (BAX)
   05165 Human papillomavirus infection
    106988699 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106988699 (BAX)
   01524 Platinum drug resistance
    106988699 (BAX)
   01522 Endocrine resistance
    106988699 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aju03029]
    106988699 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aju02000]
    106988699 (BAX)
Mitochondrial biogenesis [BR:aju03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    106988699 (BAX)
Transporters [BR:aju02000]
 Other transporters
  Pores ion channels [TC:1]
   106988699 (BAX)
SSDB
Motif
Pfam: Bcl-2 CF222
Other DBs
NCBI-GeneID: 106988699
NCBI-ProteinID: XP_026893833
UniProt: A0A6J1XMZ0
LinkDB
Position
Unknown
AA seq 192 aa
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELALEQVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcagcccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaagatcgagcagggcgaatgggggga
gagacacccgagctggccctggagcaggtaccccaggatgcgtccaccaagaagctgagc
gagtgtctcaagcgcatcggagatgaactggacagtaacatggaattgcagaggatgatc
gcagctgtggacacagactccccccgcgaggtctttttccgagtggcagcggagatgttt
tccgatggcaacttcaactggggccgggtcgtggccctcttctactttgccagcaaactg
gtgctcaaggccctgtgtaccaaggtgcccgagctgatccggaccatcatgggctggaca
ctggacttccttcgagagcggctgctgggctggatccaggaccagggtggttgggacggc
ctcctctcctactttgggacacccacgtggcagacagtgaccatctttgtggccggagtg
ctgactgcgtcactcaccatctggaaaaagatgggttga

DBGET integrated database retrieval system