KEGG   Acinonyx jubatus (cheetah): 106988702Help
Entry
106988702         CDS       T04657                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00500  Starch and sucrose metabolism
aju01100  Metabolic pathways
aju04151  PI3K-Akt signaling pathway
aju04152  AMPK signaling pathway
aju04910  Insulin signaling pathway
aju04922  Glucagon signaling pathway
aju04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106988702 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    106988702 (GYS1)
   04152 AMPK signaling pathway
    106988702 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106988702 (GYS1)
   04922 Glucagon signaling pathway
    106988702 (GYS1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04931 Insulin resistance
    106988702 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aju01003]
    106988702 (GYS1)
Enzymes [BR:aju01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     106988702 (GYS1)
Glycosyltransferases [BR:aju01003]
 Polysaccharide
  Storage polysaccharide
   106988702 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 106988702
NCBI-ProteinID: XP_014942664
LinkDB All DBs
Position
Un
AA seq 740 aa AA seqDB search
MPLSRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQNEEKPHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHIFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEHFTYEPHEADATQGYRYPPSPGPASVPPSPSLSRHSSPHQS
EDEEEPRDGPPDVDGERYDEEEEAAKDRRNIRAPEWPRRASCASSTSGSKRGSVDTAPSS
SISTPSEPLSPASSLGEERN
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaagccgcactttgtccatgtcctcactgccaggactggaggattgggaggat
gaattcgacctggagaatacagtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggcggcatctacacggtgctacagacgaaggcgaaagtgacaggggatgaatggggtgac
aactactacctggtgggaccgtacacggagcagggcgtgaggacccaggtggaactgctc
gagcccccaaccccagccctgaagaggacgttggactccatgaacagcaagggctgcaag
gtgtatttcggacgctggctgatcgaggggggccccctggtggtgctcctggacgtgggg
gcctcagcctgggccctggagcgctggaagggggagctctgggacacctgcaacatcggg
gtgccttggtacgaccgtgaggccaacgacgccgtcctttttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagaacgaggagaagccacacgtggttgcacacttccac
gagtggttggcgggcattggcctctgcctgtgccgggcccggcggctgcccgtggccaca
atcttcaccacccacgccacactgctgggacgctacctgtgtgccggtgccgtggacttc
tataacaacctggagaatttcaatgtggacaaggaagcaggggagaggcaaatctatcac
cgctactgcatggagcgggcagcggcccactgcgctcatatctttactactgtgtcccag
attactgccatcgaggctcagcacctgctcaagaggaaaccagatatcgtgacccccaat
ggactgaatgtgaagaagttctctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcacctggacttcaacttg
gacaagaccttgtatttctttatcgccggccgctacgagttctctaacaagggggccgat
gtcttcctagaggccttggcccggctcaactatctactcagagtgaacggcagtgagcag
acagtggtcgccttcttcatcatgccggctcggaccaacaatttcaacgtggaaaccctc
aaaggccaggctgtgcgcaagcagctttgggatacagccaacaccgtgaaagagaagttc
ggaaggaagctttacgagtccttgctggtggggagcctcccggacatgaacaagatgctg
gacaaggaggacttcactatgatgaagagagctatctttgccacgcagcgacagtctttc
ccccctgtgtgcacccacaatatgctggacgactcctcggatcctatcctgaccaccatc
cgtcgaatcggactcttcaatagtagtgctgacagggtcaaggtgattttccacccagag
ttcctctcctccacgagccccctgctccccgtggattatgaggaatttgtccgtggctgc
cacctgggggtcttcccctcctactatgagccttggggctacacgccggctgagtgcacg
gttatgggcatccccagtatctccaccaacctctccggcttcggctgcttcatggaggaa
cacattgcagacccctcagcttacggcatctacattctggaccggcggttccgcagcctg
gatgattcctgctcgcagctcacctccttcctctacagcttctgccagcagagccggcgg
cagcgcatcatccagagaaaccgcacggagcgcctctcagaccttctagactggaaatac
ctaggccggtactatatgtccgcgcgccacatggcgctggccaaggcctttccagaacac
ttcacctatgagccccacgaggctgacgcgacccagggctaccgctaccccccctcccct
gggccggcctccgtgccgccatcgccctcgctgtcgcgacactcaagccctcaccagagc
gaggacgaggaggagccacgggacgggccgcccgacgtagacggggagcgctacgatgag
gaagaggaggccgccaaggaccggcgcaacatccgcgcccccgagtggccgcgccgcgcc
tcctgtgcctcttccaccagcgggagcaagcgcggctccgtggacacagcgccctccagc
tcaatcagcactcccagcgagcccctcagccccgccagctccctgggcgaggagcgcaac
taa

DBGET integrated database retrieval system