KEGG   Acinonyx jubatus (cheetah): 106988817
Entry
106988817         CDS       T04657                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju01523  Antifolate resistance
aju04010  MAPK signaling pathway
aju04014  Ras signaling pathway
aju04062  Chemokine signaling pathway
aju04064  NF-kappa B signaling pathway
aju04151  PI3K-Akt signaling pathway
aju04210  Apoptosis
aju04380  Osteoclast differentiation
aju04620  Toll-like receptor signaling pathway
aju04621  NOD-like receptor signaling pathway
aju04622  RIG-I-like receptor signaling pathway
aju04623  Cytosolic DNA-sensing pathway
aju04625  C-type lectin receptor signaling pathway
aju04657  IL-17 signaling pathway
aju04658  Th1 and Th2 cell differentiation
aju04659  Th17 cell differentiation
aju04660  T cell receptor signaling pathway
aju04662  B cell receptor signaling pathway
aju04668  TNF signaling pathway
aju04920  Adipocytokine signaling pathway
aju05132  Salmonella infection
aju05135  Yersinia infection
aju05142  Chagas disease
aju05145  Toxoplasmosis
aju05160  Hepatitis C
aju05161  Hepatitis B
aju05162  Measles
aju05163  Human cytomegalovirus infection
aju05164  Influenza A
aju05165  Human papillomavirus infection
aju05166  Human T-cell leukemia virus 1 infection
aju05167  Kaposi sarcoma-associated herpesvirus infection
aju05168  Herpes simplex virus 1 infection
aju05169  Epstein-Barr virus infection
aju05170  Human immunodeficiency virus 1 infection
aju05200  Pathways in cancer
aju05203  Viral carcinogenesis
aju05212  Pancreatic cancer
aju05215  Prostate cancer
aju05220  Chronic myeloid leukemia
aju05221  Acute myeloid leukemia
aju05222  Small cell lung cancer
aju05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aju05340  Primary immunodeficiency
aju05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106988817 (IKBKG)
   04014 Ras signaling pathway
    106988817 (IKBKG)
   04064 NF-kappa B signaling pathway
    106988817 (IKBKG)
   04668 TNF signaling pathway
    106988817 (IKBKG)
   04151 PI3K-Akt signaling pathway
    106988817 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106988817 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106988817 (IKBKG)
   04621 NOD-like receptor signaling pathway
    106988817 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    106988817 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    106988817 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    106988817 (IKBKG)
   04660 T cell receptor signaling pathway
    106988817 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    106988817 (IKBKG)
   04659 Th17 cell differentiation
    106988817 (IKBKG)
   04657 IL-17 signaling pathway
    106988817 (IKBKG)
   04662 B cell receptor signaling pathway
    106988817 (IKBKG)
   04062 Chemokine signaling pathway
    106988817 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    106988817 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    106988817 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106988817 (IKBKG)
   05203 Viral carcinogenesis
    106988817 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    106988817 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    106988817 (IKBKG)
   05221 Acute myeloid leukemia
    106988817 (IKBKG)
   05220 Chronic myeloid leukemia
    106988817 (IKBKG)
   05215 Prostate cancer
    106988817 (IKBKG)
   05222 Small cell lung cancer
    106988817 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    106988817 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    106988817 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106988817 (IKBKG)
   05135 Yersinia infection
    106988817 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106988817 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    106988817 (IKBKG)
   05162 Measles
    106988817 (IKBKG)
   05164 Influenza A
    106988817 (IKBKG)
   05161 Hepatitis B
    106988817 (IKBKG)
   05160 Hepatitis C
    106988817 (IKBKG)
   05168 Herpes simplex virus 1 infection
    106988817 (IKBKG)
   05163 Human cytomegalovirus infection
    106988817 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106988817 (IKBKG)
   05169 Epstein-Barr virus infection
    106988817 (IKBKG)
   05165 Human papillomavirus infection
    106988817 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    106988817 (IKBKG)
   05142 Chagas disease
    106988817 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    106988817 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aju01001]
    106988817 (IKBKG)
Protein kinases [BR:aju01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   106988817 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 LLC1 ABC_membrane_2
Other DBs
NCBI-GeneID: 106988817
NCBI-ProteinID: XP_026909088
UniProt: A0A6J1YYJ1
LinkDB
Position
Unknown
AA seq 419 aa
MSRPPWKSQLCEMVQPSGGPAGDQDVLGEESSLGKPAMPHLPSEQGTPETFQRCVEENQE
LRDAIRQSNQMLRERCEELQRFQGSQRKEKEFLMQKFQEARKLVERLSLEKLDLRRQREQ
ALQEVEHLKRCQKQLAEDKASVKAQVTSLLGELQESQSRLEAAIKERQALEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQSQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDSHIKSSVVSSERNRGLQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPV
LKAQADIYKADFQAERQAREKLAEKKEILQEQLAQLQRDYSRLKASCQESARIEDMRKRH
VEASQAPVAPAPAHPSFHLALPNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagcaggcccccctggaagagtcagctgtgtgagatggtgcagcccagcggcggcccg
gcaggggaccaggacgtgctgggtgaagagtcttctctggggaagccagctatgccccac
ctaccttctgagcagggcactcctgagaccttccaacgctgtgtggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagatgcttcgggagcgctgtgaggagctgcag
cgtttccaaggcagccagaggaaggagaaggagttcctcatgcagaaattccaggaagcc
aggaaactggtggagagactgagcctggagaagctcgacctgaggagacagagggagcag
gccctgcaggaggtggaacatctgaagagatgccaaaagcagttggctgaggacaaggcg
tcagtgaaagcccaggtgacgtccttgctgggggagctccaagagagccagagtcgcttg
gaggccgccatcaaagagcgacaggctttggagggcagggcccgggctgccagtgagcag
gcccggcagctggagagcgagcgggaggccctgcagcagcagcatagcgtgcaggtggac
cagctgcgcatgcagagccagagcgtggaggccgcgctgcgcatggagcgccaggccgcc
tcggaggagaagcggaagctggcgcagctacaggtggcctatcaccagctcttccaggag
tacgacagccacatcaagagcagcgtggtgagcagcgagcggaaccgaggactgcagctg
gaggacctgaagcagcagctgcaacaggccgaggaggccctggtggccaagcaggaagtg
attgacaagctgaaggaagaggccgagcagcacaagatagtgatggagactgttccggtg
ctaaaagcccaggcggacatctacaaggccgacttccaggccgagaggcaggcccgggag
aagctggccgagaagaaggagattctgcaggagcagctggcccagctgcagcgggactac
agccgcctgaaggccagctgccaggagtctgccaggattgaagatatgaggaagcggcac
gtggaggcctcccaggcccccgtagcccctgccccagctcacccctccttccacctggcc
ctgcccaaccagaggagaagcccccccgaggagccgcctgacttctgttgccccaagtgc
cagtatcaggctcccgatatggacaccctgcagatacatgtcatggagtgcatcgagtag

DBGET integrated database retrieval system