KEGG   Acinonyx jubatus (cheetah): 106989694Help
Entry
106989694         CDS       T04657                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease serine 9 isoform X1
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
aju  Acinonyx jubatus (cheetah)
Brite
KEGG Orthology (KO) [BR:aju00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:aju01002]
    106989694 (TMPRSS9)
Enzymes [BR:aju01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     106989694 (TMPRSS9)
Peptidases [BR:aju01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   106989694 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 Ldl_recept_a SEA
Motif
Other DBs
NCBI-GeneID: 106989694
NCBI-ProteinID: XP_026905146
LinkDB All DBs
Position
Unknown
AA seq 1085 aa AA seqDB search
MEPTAGDLQLVPGTAKEVPAPYTSCCRMALCVVVATSIIMVTLGVLMASLSTQGVDVEHT
AELQGVRYAHSLQHEASDYYRTLTPALEWLFVSSFRETELEASCVRCTVLSYRDGNSSVF
VHFRLHFLLQASQSLSLGLEEELLRQGLRARLQGHGIPLAAHGTIVSAQLTGSQKAPWTE
RDLKSGHCPGNTFSCHNGQCVTKVNPECDDRVDCSDGSDEAHCDCGLQPGWKTAGRIVGG
VEASPGEFPWQVSLRENKEHFCGAAVIGARWLVSAAHCFNGFQDPAEWVAYAGTTHLSGA
EASTVRVRVARITPHPLYNPDTADFDVAVLELDGPLAFGRHVQPVCLPAATHVFPPRRKC
LISGWGYLKEDFLVKPETLQKATVELLDQGLCASLYGHSLTDRMLCAGYLDGKVDSCQGD
SGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGVYARVTRLRDWILEAITTAGRPLAPTA
APASTTASTARPTRPESPTRPTLGLSATPPDSVTASKPQECGARPAMEKPTRIVGGLGAV
SGEVPWQVSLKEGSRHFCGATVVGDRWLLSAAHCFNHTKVELVRAHLGTASLTGVGGNPV
KMGLKRAVLHPQYNPSILDFDVAVLELAGPLGFNKYIQPVCLPLAIQKFPVGRKCMISGW
GNTQEGNATKPDILQRASVGIIDQKACSALYNSSLTDRMLCAGFLEGKVDSCQGDSGGPL
ACEEAPGVFYLAGIVSWGVGCAQARRPGVYARITRLKGWILDTMSSGLLPTARTPATRQS
SGTAAAFTVPGVPASTATPSATSRANSQPANMTAATVSATAGGQTPLPDAPRTTVGFQPP
DCGLAPVAAMTRIVGGSAAARGEWPWQVSLWLRRREHRCGAVLVAERWLLSAAHCFDVYG
DPKQWAAFLGTPFLSGAEGQLERVARIYKHPFYNLYTLDYDVALLELAGPVRRGRLVRPI
CLPEPTPRPPDGARCVITGWGSVREGGSMARQLQKAAVRLLSEQTCRRFYPVQISSRMLC
AGFPQGGVDSCSGDAGGPLACREPSGRWVLTGVTSWGYGCGRPHFPGVYTRVAAVRGWIG
QNIQE
NT seq 3258 nt NT seq  +upstreamnt  +downstreamnt
atggagcccaccgctggtgacttacagcttgtgcctgggacagcaaaggaagtcccagct
ccctacacctcgtgctgccgcatggccctctgcgttgttgtggccaccagcatcatcatg
gtcaccctgggagtcctcatggcctccctctctacacagggtgtcgacgtggagcacacg
gcggagctgcaaggggtccgctatgcccacagcttgcagcacgaggcctcggactactac
cgcaccctgacgcccgctctggaatggctgtttgtgagcagctttcgggagaccgagttg
gaggccagctgtgtgcgctgcaccgtgctaagttacagggatgggaattccagcgtcttc
gtgcatttccggctgcacttcctgctgcaggcctcgcagtcactgagtctgggcctagag
gaggagctgttgcggcagggactccgagcgaggctgcaggggcacggtatccccctggct
gcccacggcaccattgtgtccgcccagctcacaggaagccagaaagcgccatggacagaa
agagatttaaaatcaggtcactgcccagggaacaccttttcctgccacaatggccagtgt
gtgaccaaagtgaacccggagtgtgacgacagagtggactgctctgacggatctgatgag
gcccactgtgactgtggtctacagcccggctggaagacagccggccggatcgtgggtggc
gtggaagcatctccgggagagttcccgtggcaagtcagccttcgagaaaacaaggaacac
ttctgtggggctgctgtcatcggggccaggtggctggtgtccgcggcccactgcttcaat
ggattccaagacccggcggagtgggtggcctacgcaggcacgacccacctcagtggcgca
gaggccagcacggtgcgggtgcgcgtggcccgcatcaccccgcaccccctgtacaacccg
gacacggccgacttcgacgtggcggtgctggagctggacggccctctggcctttggcagg
cacgtccagcccgtgtgcctgcctgccgccacgcacgtcttcccgccgcggaggaagtgc
ctcatctccggctggggctacctcaaggaggacttcctggtcaagccagaaacgctgcag
aaagccacagtggagctgctggaccagggcctgtgtgccagcctgtacggccactcgctc
accgacaggatgctgtgtgccggctacctggacgggaaggtggattcctgccagggcgac
tcgggaggccccctagtctgcgaggagccctctggcaggttcttcctggccggcatcgtg
agctggggaataggttgtgcggaagcccgacgccccggcgtctatgcccgagtgaccagg
ctgcgtgactggatcctggaggccatcaccacggcaggccggcctctggcccccacggcg
gctcccgcctccaccaccgccagcactgcccggcccacccgtcctgagagccccaccagg
cccactctgggcctcagcgccacgcctcccgactcagtcaccgcctctaagccacaagag
tgcggggccaggcccgccatggagaagcccactcggatcgtgggcgggctgggagccgtg
tccggggaagtgccctggcaggtcagcctgaaggaaggttcccggcacttctgtggcgcc
accgtggtgggggaccgctggctgctgtcggccgcccactgcttcaaccacacgaaggtg
gagctggtgcgggcccacctgggcaccgcgtccctcacgggcgtcggcggaaacccagtg
aagatggggctcaagcgggcagtgctgcacccccagtacaaccccagcatcctggacttc
gatgtggccgtgctggagctggccgggcccctgggtttcaacaagtacatccagcctgtc
tgcctgcccctggctatccagaagttccctgtgggccggaagtgcatgatctccggctgg
ggtaacacccaggagggaaacgccaccaagcctgacattctgcagagagcgtctgtgggc
atcatagaccagaaggcgtgcagcgcactctacaactcctccctcacggacaggatgctc
tgcgccggcttcctggagggcaaagtggactcctgccagggcgactccgggggacccctg
gcctgcgaggaggcccccggtgtgttttacctggcggggattgtgagctggggggtcggc
tgcgctcaggcccggagacctggcgtgtacgctcgaatcaccaggctgaagggctggatc
ctggacaccatgtcctctgggctcctccccaccgcgaggacccccgccaccaggcagtcc
tctgggacggcagcagccttcacagtcccgggagtcccggccagcacagccaccccctcg
gccaccagcagggcaaacagccagcccgccaacatgactgcagccaccgtaagcgccact
gctgggggacagacacccctcccagacgccccgaggaccactgtgggcttccagccacca
gactgtggcctggcaccggtggcagcgatgaccaggatcgtgggcggcagcgccgcggcc
cgcggggagtggccgtggcaggtgagcctgtggctgcggcgccgggagcaccgctgcggg
gccgtcctggtggccgagaggtggctgctgtcggcggcgcactgctttgatgtctacggg
gaccccaagcagtgggcggccttcctgggcacgccgttcctgagtggcgccgaggggcag
ctggagcgggtggcgcgcatctacaaacaccccttctacaacctctacacgctcgactac
gacgtggcgctgctcgagctggcggggcccgtgcgccgcggccgcctggtgcggcccatc
tgcctgcccgagcccacgccgcggccccccgacggcgcgcgctgcgtcatcaccggctgg
ggctcggtgcgcgagggaggctcgatggcgcggcagctgcagaaggcggccgtgcgcctc
ctcagcgagcagacgtgccgccgcttctacccggtgcagatcagcagtcgcatgctgtgc
gccggcttcccgcagggcggcgtggacagctgttcgggcgacgccgggggacccctggcc
tgcagggagccctctggccggtgggtgctaactggggtcaccagctgggggtacggctgt
gggcggccccacttcccaggggtctatactcgggtggctgccgtcagaggctggatcggg
cagaacatccaggagtga

DBGET integrated database retrieval system