KEGG   Acinonyx jubatus (cheetah): 106989943Help
Entry
106989943         CDS       T04657                                 

Gene name
MPO
Definition
(RefSeq) myeloperoxidase isoform X1
  KO
K10789  myeloperoxidase [EC:1.11.2.2]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju00983  Drug metabolism - other enzymes
aju04145  Phagosome
aju05202  Transcriptional misregulation in cancer
aju05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:aju00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    106989943 (MPO)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    106989943 (MPO)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    106989943 (MPO)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    106989943 (MPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aju04147]
    106989943 (MPO)
Enzymes [BR:aju01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.2  myeloperoxidase
     106989943 (MPO)
Exosome [BR:aju04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106989943 (MPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 106989943
NCBI-ProteinID: XP_026890021
LinkDB All DBs
Position
Unknown
AA seq 729 aa AA seqDB search
MEVGQGYEEMKLLLALAGLLLAILAVPQPSEGAGPAVLEAVETSVVLTCMEEAKRLVDTA
YKEQRESIKQRLRSGLASPMDLLSYFKQPVAATRTAVRAADYLHVALSLLEGKLRPLRPG
PLNITDVLTPAQLNLLSKSSGCAYQDVGVTCPENDKYRTITGQCNNRRSPTLGASNRAFA
RWLPAEYEDGFSLPFGWTPGVKRGGFPVPLARAVSNAIVRFPTEQLTPDQERSLLFMQWG
QLIDHDLDLSPDPGALASFITSVDCETSCEQEPPCFPLKIPPDDPRIRNQRDCIPFFRSS
PACTESNITIRNQINALTSFVDASMVYGSEDSLATKLRNLTNQLGLLAVNTRFSDNGRAL
LPFDNLRDDPCLLTNRSARIPCFLAGDSRSSEMPELTSMHTLFLREHNRLATQLKRLNPG
WDGERLYQEARKIVGAMVQIITYRDYLPLVLGPQALRKYLPSYRSYNDSVDPRISNVFTN
AFRYGHTLIQPFMFRLDNQYQPMGPNPRVPLSKVFFATWRVVLEGGIDPILRGLMATPAK
LNRQNQIAVDEIRDRLFEQVMRIGLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPRSVGE
LATVMKNLGLAQKLMQQYGTPDNIDIWMGGVAEPLEPNGRVGPLLACLIGTQFRKLRDGD
RFWWENQGVFTRQQQQALAKISLPRIICDNTGITTVSKDNIFMSNTFPRDFVSCNTLPAL
DLTPWRQSD
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggaggttggacaggggtatgaagagatgaagctgctgctggcgcttgcagggctcctc
ctggccattctggcggtgccccagccctctgagggtgccggtccagctgtcctggaggca
gtagagacctcggtggtgctgacctgcatggaggaggccaagcggctagtggacacggcc
tacaaggaacagcgggagagcatcaagcagcggcttcgcagtggcttggccagccccatg
gatctcctgtcctacttcaagcagccggtggcagccaccaggacagccgtgagggctgct
gactatctgcatgtggccctaagcctgctggaggggaagctgcggcctctgcggccaggg
cccctcaacatcaccgacgtgctgacacccgcgcagctgaatctgctgtccaagtccagc
ggctgcgcctaccaggacgtgggggtgacgtgccccgagaacgacaagtaccgcaccatc
accgggcagtgcaacaacagacgcagtcccacgctgggggcctccaaccgcgccttcgcg
cgctggctgccggctgagtacgaggacggcttctcgctgcccttcggctggacgcccggg
gtcaagcgcggcggcttcccggtccccctggcgcgcgccgtctccaacgccatcgtgcgc
ttccccacggagcagctgaccccggaccaggagcgctcgctgctgttcatgcagtggggc
cagctgattgaccacgacctcgacttgagcccggatcccggcgccctggcgtccttcatc
actagtgtcgactgcgagaccagctgcgagcaggagcctccctgcttcccgctcaagatc
ccaccagatgacccccgcatcaggaaccagcgtgactgcatccccttcttccgctcctcc
ccagcctgcacagagagcaacatcaccatccgcaaccagatcaatgcgctcacctctttc
gtggacgccagcatggtgtatggcagcgaggactctttggccactaagcttcgaaacctg
accaaccagctggggctgctggccgtcaacacccgcttcagtgacaatggtcgggccctg
ctgccctttgacaacctgcgtgatgacccctgcctcctcaccaaccgctctgcgcgcatc
ccctgcttcctggcaggggactcccgctcaagtgagatgcccgagctcacctccatgcac
acactctttttgcgggagcacaaccggctggccacacaactcaagcgcctgaacccaggc
tgggatggagagaggctctaccaagaagctcgcaagatcgtgggagccatggtccagatc
atcacttaccgggactacctgcccctggtgctgggaccacaggccctgaggaagtacctg
ccgagctacagatcatacaatgactcggtggaccctcgaatctccaatgtcttcaccaat
gccttccgctatggccacaccctcatccaacctttcatgttccgcctggataaccagtac
cagcccatggggcccaacccccgcgttccactcagcaaggtcttttttgctacctggaga
gtagtgctggaaggtggtattgatcccatccttcggggcctcatggccacccctgccaag
ctgaatcgccagaaccaaatcgcggtggatgagatccgggaccggttgtttgagcaggtc
atgaggatcgggctggacctgcctgccctgaacatgcagcgcagccgggaccacggcctc
ccagggtacaatgcctggcggcgcttctgtgggctcccgcagccccgctcggtgggcgag
ctggccacagtgatgaagaacctgggcctggcccagaagctgatgcagcagtatggcacc
cccgacaacattgacatctggatgggcggtgtggccgagcccctggagcccaacggccgc
gtgggcccgctccttgcctgcctcattgggacccagttcaggaagctccgagacggtgac
cggttttggtgggagaaccagggcgtgttcaccaggcagcagcagcaggcgctggccaag
atctccttgccccgcatcatctgtgacaacacgggcatcaccaccgtgtccaaggacaac
atcttcatgtccaacacattcccccgggactttgtcagctgcaatacgctccctgcattg
gacctgactccctggaggcagagtgactag

DBGET integrated database retrieval system