KEGG   Acinonyx jubatus (cheetah): 106989948Help
Entry
106989948         CDS       T04657                                 

Gene name
RAD51C
Definition
(RefSeq) DNA repair protein RAD51 homolog 3
  KO
K10870  RAD51-like protein 2
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju03440  Homologous recombination
aju03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:aju00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    106989948 (RAD51C)
   03460 Fanconi anemia pathway
    106989948 (RAD51C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aju03400]
    106989948 (RAD51C)
DNA repair and recombination proteins [BR:aju03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     106989948 (RAD51C)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     106989948 (RAD51C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad51 AAA_25 ATPase RecA HHH_5 AAA_18 AAA_24 AAA AAA_33
Motif
Other DBs
NCBI-GeneID: 106989948
NCBI-ProteinID: XP_014943899
LinkDB All DBs
Position
Unknown
AA seq 360 aa AA seqDB search
MQRDLVSFPLSPAVRVKLVSAGFQTAEELLEMKPSELSKEVGISKEEALETLQIIGRECL
TNKPRYAAESGKKCTALELLEQEHTQSFIITFCSALDNILGGGIPLTKTTEICGVPGVGK
TQLCMQLAVDVQIPECFGGVEGEAVFIDTEGSFMVDRVVDLATACIQHLHLIAEAHMGEE
HPKALEDFTLENILSHIYYFRCRDYTELLAQVYLLPDFLSEHSKVRLVIVDGIAFPFRHD
LDDLSLRSRLLNGLAQQMISLANNHRLAVLLTNQMTTKIDRNQALLVPALGESWGHAATI
RLIFHWDQNQRLATLCKSPSQKESTVLFQITPQGFRDAVVAPACSWQTEGSLNSRKRSRE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgggatttagtgagtttcccgctgtccccagcggtgcgggtgaagctggtgtct
gcaggtttccagactgctgaggaactcctagagatgaaaccatccgagctcagcaaagaa
gttgggatatctaaagaggaagcattagaaactctgcaaattataggaagagaatgtctc
acaaataaaccaagatatgctgctgagtcaggcaagaagtgtacagcactggaacttctt
gagcaggagcatacccagagcttcataattaccttctgttcagcactagataatattctt
gggggtggaatacccttaaccaaaacaacagaaatttgtggagtaccaggtgttggaaaa
acacaattatgtatgcagttggcagtagatgtgcagataccagaatgttttggaggagtg
gaaggtgaagcagtttttattgatactgaaggaagttttatggttgatagagtggtagac
cttgctactgcctgcattcagcaccttcaccttatagcagaagcacatatgggagaggag
cacccaaaagctttggaggatttcactcttgaaaatattctttcccatatttactatttt
cgttgtcgtgactacacagagctattggcacaagtttatctcctcccagacttcctttca
gaacactcaaaggttcgattagtgatagtggatggtattgcttttccttttcgtcatgac
ctagatgacctctcccttcgtagtcgattactaaatggtctagcccagcaaatgatcagc
cttgcaaataaccacagattagctgtacttttaactaatcagatgacaacaaaaattgat
agaaatcaggccttgctggttcctgcattgggggaaagctggggacatgctgctacaata
cggctaatctttcattgggaccaaaatcaaaggttggcaacattgtgcaaatcaccaagc
cagaaggaatctacagtactgtttcaaatcacacctcagggatttagagatgctgttgtt
gctcctgcatgttcttggcaaacagaaggttcattgaattcccggaaacggtcacgagaa
tga

DBGET integrated database retrieval system