KEGG   Acinonyx jubatus (cheetah): 113596350Help
Entry
113596350         CDS       T04657                                 

Gene name
MATK
Definition
(RefSeq) megakaryocyte-associated tyrosine-protein kinase isoform X1
  KO
K08888  megakaryocyte-associated tyrosine kinase [EC:2.7.10.2]
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:aju00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    113596350 (MATK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aju01001]
    113596350 (MATK)
Enzymes [BR:aju01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     113596350 (MATK)
Protein kinases [BR:aju01001]
 Non-receptor tyrosine kinases
  CSK family
   113596350 (MATK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_2 SH3_9 Kinase-like Haspin_kinase RIO1 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 113596350
NCBI-ProteinID: XP_026905101
LinkDB All DBs
Position
Unknown
AA seq 485 aa AA seqDB search
MRVSPRFLRAWRPTFVSARMPTRRWAPGTQCITKCEHTRPKPGELAFHKGDVVTILEACE
SKSWYRAKHHASGQEGLLAAGALREREALSADPKLSLMPWFHGKISGQEAVQQLQPPEDG
LFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVCFCNLMDMVEHYSKDKGA
ICTKLVKPKRKQGTKSAEEELAKAGWLLNLQHLTLGARIGEGEFGAVLQGEYLGQKVAVK
NVKCDVTAQAFLDETAVMTKIQHKNLVRLLGVILHQGLYIVMEHVSKGNLVNFLRTRGRA
LVSTPQLLQFSLHVAEGMEYLESKKLVHRDLAARNILISEDLVAKVSDFGLAKAERKGLD
SSRLPVKWTAPEALKHGKFSSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEAVEKGYR
MEPPEGCPGPIHALMGSCWEAEPARRPPFRKLAEKLARELRSAGASAPVAGQDTDSSSSP
RGQEP
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgagcccccgcttcctccgtgcctggcgccccacgttcgtctcagccaggatg
ccaacaaggcgctgggccccaggcacccaatgcatcaccaagtgtgagcacacgcgcccc
aagccaggagagctggccttccacaagggtgacgtggtcaccatcctggaggcctgtgag
agcaagagctggtaccgtgccaagcaccacgccagcgggcaggagggtctgctggcggcg
ggggcgctgcgggagcgggaggccctatcggccgaccccaagctcagcctcatgccgtgg
ttccacgggaagatctcgggccaggaggccgtgcagcagctgcagccgccggaggacggg
ctgttcctggtgcgagagtccgcgcggcatccgggcgactacgtgctatgcgtgagcttc
ggccgcgacgtcatccactaccgcgtgctgcatcgcgacggccacctgaccatcgacgag
gccgtctgcttctgcaacctcatggacatggtggagcattacagcaaggacaagggggcc
atctgcacgaagctagtgaaacccaagaggaagcagggcaccaagtccgcagaggaggag
ctggccaaagccggctggttactgaacctacagcatttgacgctgggtgcgcggattgga
gagggtgagtttggagcagtcctgcagggtgagtacctgggacagaaggtggccgtgaag
aacgtcaagtgcgatgtgacggcccaggccttcctggacgagacggcggtcatgacgaag
atccagcacaagaacctggtgcgtctgctgggcgtgatcctgcaccaggggctctacatc
gtcatggagcacgtgagcaagggcaacctggtgaactttctccggacacgaggccgggcc
ctcgtcagcacgccccagctactgcaattttccttgcacgtggctgagggcatggagtac
ctggagagcaagaagctggtgcaccgagaccttgccgcccgcaacatcctcatttccgag
gacctggtggccaaggtcagtgactttggcctggccaaagccgagcggaaggggctggac
tcaagccggctgccggtcaaatggacggcgcccgaggctctcaaacacgggaagttctcc
agcaagtcggatgtctggagtttcggggtgctcctttgggaggttttctcatacggccgg
gctccataccccaagatgtcactgaaggaggtgtcggaggccgtggagaaggggtaccgc
atggagccccccgagggctgcccgggccccattcacgccctcatgggcagctgctgggag
gctgagcctgcccgccggccgcccttccggaaactggcagagaagctggcccgggagctg
cgcagcgcgggggcctcggccccggtggcgggccaggacacggacagttcctcctcgccc
cgaggccaggagccctga

DBGET integrated database retrieval system