KEGG   Acinonyx jubatus (cheetah): 113597168
Entry
113597168         CDS       T04657                                 

Gene name
IL3RA
Definition
(RefSeq) LOW QUALITY PROTEIN: interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04060  Cytokine-cytokine receptor interaction
aju04151  PI3K-Akt signaling pathway
aju04210  Apoptosis
aju04630  JAK-STAT signaling pathway
aju04640  Hematopoietic cell lineage
aju05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    113597168 (IL3RA)
   04151 PI3K-Akt signaling pathway
    113597168 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113597168 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113597168 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113597168 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113597168 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:aju04050]
    113597168 (IL3RA)
   04090 CD molecules [BR:aju04090]
    113597168 (IL3RA)
Cytokine receptors [BR:aju04050]
 Interleukin receptor families
  IL3 receptor family
   113597168 (IL3RA)
CD molecules [BR:aju04090]
 Proteins
  113597168 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 113597168
NCBI-ProteinID: XP_026908705
UniProt: A0A6J1YXF0
LinkDB
Position
Unknown
AA seq 395 aa
MAFLWLALCLTPACCLLHRDEDPEPPIKNLRMQPETRRLTWDLSGNVSEIGCFINSRLIT
KAVDKPYCQFRVLPSCQVTNFTVASTGDPPFSAGILYPRPEGHPEAAAQRLGCWVHDVDF
LTCSWEAGRAAPGDVQYRLYWQDLKTYEEEECPRYGVDDRGTHIRCHFDDVSRLREHVQF
LVKGTSKGARIPCSDLTVELARIERLSLPNITGMCNKSYSIMEWKMSSHFNHRFTYELEI
QKGSDPAYTEKAPGSYFVLRNPGNYAVRLRAHARFRQTWSEWSAVRRFGLGSFQEEKLRT
QTRXEGRPECDLGKDTHFRDWLTSALIPLGALLALGLGVALCRRYSVLQKLFPPIPHLKD
PISDNLHSSKLVAWEASRASREDCQVAEVQVLGET
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggccttcctgtggctggccttgtgtctcacgcccgcgtgctgtctgctgcacagggac
gaagatcccgagccgccgattaagaacctgcgaatgcagccggagacgagaaggttgacc
tgggacctcagcggaaacgtgtctgagattggctgtttcatcaactcgaggctgatcact
aaggccgtggacaagccttactgccagttccgcgtacttccctcgtgtcaggtgacgaat
ttcacggtcgcctccaccggagacccaccgttctccgcagggatcctgtaccccaggcca
gagggccaccctgaggcggccgcgcagcgtctgggctgctgggtgcacgacgtggacttc
ctgacgtgcagctgggaggcgggccgcgcggcccccggtgacgtccagtatcgcctgtac
tggcaggacctcaagacctacgaggaggaggagtgtccccggtacggggtggacgatcgg
gggacacacatccggtgtcatttcgacgacgtgtcccggctcagggaacacgtccagttc
ctggtgaagggcaccagcaagggcgcgaggatcccctgctccgacctcactgtggaactg
gcaagaatcgagagattaagtctgcccaacatcaccggaatgtgtaataaatcgtattca
atcatggaatggaaaatgtcaagccactttaatcacagatttacatacgaacttgaaata
caaaagggctcagatcccgcctacaccgagaaggcgcccggcagctacttcgtgctccgc
aatcccggaaactacgcggtgaggctgagggcgcacgcgcgcttccgccaaacctggagc
gagtggagcgccgtccggcgctttggactggggtcctttcaagaagagaagttgaggaca
cagacacgcnnagagggacggccagagtgcgacctcgggaaggacacgcacttccgagac
tggctgacctccgctctgatcccgctgggcgcgctgctggccctggggctgggggtcgcg
ctgtgccgaaggtactcggtgctgcagaagctcttccccccgatcccgcacctgaaggac
cccatcagtgacaacctgcacagcagcaagttggtggcctgggaggccagcagagcaagc
cgggaggactgccaggtggcggaggtgcaggttctgggagaaacgtga

DBGET integrated database retrieval system