KEGG   Acinonyx jubatus (cheetah): 113604567
Entry
113604567         CDS       T04657                                 

Gene name
IL3
Definition
(RefSeq) interleukin-3
  KO
K04736  interleukin 3
Organism
aju  Acinonyx jubatus (cheetah)
Pathway
aju04060  Cytokine-cytokine receptor interaction
aju04151  PI3K-Akt signaling pathway
aju04210  Apoptosis
aju04630  JAK-STAT signaling pathway
aju04640  Hematopoietic cell lineage
aju04664  Fc epsilon RI signaling pathway
aju05200  Pathways in cancer
aju05202  Transcriptional misregulation in cancer
aju05221  Acute myeloid leukemia
aju05310  Asthma
Brite
KEGG Orthology (KO) [BR:aju00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    113604567 (IL3)
   04151 PI3K-Akt signaling pathway
    113604567 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113604567 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    113604567 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    113604567 (IL3)
   04664 Fc epsilon RI signaling pathway
    113604567 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113604567 (IL3)
   05202 Transcriptional misregulation in cancer
    113604567 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    113604567 (IL3)
  09163 Immune disease
   05310 Asthma
    113604567 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aju04052]
    113604567 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:aju00536]
    113604567 (IL3)
Cytokines and growth factors [BR:aju04052]
 Cytokines
  Interleukins
   113604567 (IL3)
Glycosaminoglycan binding proteins [BR:aju00536]
 Heparan sulfate / Haparin
  Cytokines
   113604567 (IL3)
SSDB
Motif
Pfam: IL3 DUF4089
Other DBs
NCBI-GeneID: 113604567
NCBI-ProteinID: XP_026932814
UniProt: A0A6J2AWD9
LinkDB
Position
Unknown
AA seq 143 aa
MSNLPIMYLLLLLLGFQAPQAQGRPFPTYQLNQYLAKIDEIMQILNKLPLPSQDPLDPNE
TEILRENTLLRPNLDAFLKAAENFHEDGLLIWKNLKEFLPLLPTPTPRGDPIHIEEDNWV
DFQRKLTKYLEILDNFLTFKEKH
NT seq 432 nt   +upstreamnt  +downstreamnt
atgagcaaccttcccatcatgtaccttctcctgcttcttcttggattccaagcccctcag
gcacaggggcggccctttccgacataccagctgaaccaatacttggcaaagattgatgaa
attatgcagatcttaaacaagttacccttgccttcacaggaccccttggacccaaatgag
acagagatcctgagggaaaacacccttctgaggccaaacctggatgcattcttaaaagct
gcagaaaatttccatgaagatggactgctaatctggaaaaatcttaaggaattcctgcca
ctcctgcccactcccacacccaggggagacccaatccatatcgaggaggataactgggtt
gatttccaaaggaaactgactaaatatctggaaatccttgataactttctgactttcaag
gagaaacactga

DBGET integrated database retrieval system