KEGG   Advenella kashmirensis: TKWG_00215Help
Entry
TKWG_00215        CDS       T02117                                 

Definition
(GenBank) sorbitol dehydrogenase
Organism
aka  Advenella kashmirensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFK60767
UniProt: I3U6X9
LinkDB All DBs
Position
37084..38124
Genome map
AA seq 346 aa AA seqDB search
MLAVRKTSPVHGVSLDDIPEPDSPASGEVIVAVVAVGICGSDVHVYEWTSGYEFMRSRLP
VVLGHEFSGKIAAVGDDVVGLRVGDSVVVMPGISCMRCVTCARGTPHLCPNKETLGLTRD
GAFASHVRVPASGCIPIPAETDLSLAALTEPLCVGDNACDVGQVTAGDTVVVLGPGTIGQ
AIVRAARWRGASRVIAVGMNDAARLEVAQAMGATHCIDLADGISLQQGIHRITGGKPADV
VIEATGHASSITEGLQILRKGGILAAAGIHAQRASFDLTEMIRNKQQIRGAHGSRRQNWE
RIIDRIVHEPESVRPMISMELKINDAEQGFRQCLARSVSKVILRPD
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgctagcagtcagaaaaacgagtccggtgcatggagtatcgctggatgatattccagaa
cccgatagtcccgcttctggggaggtcatcgtcgcggtagttgcagtcggcatttgtgga
tctgatgttcatgtctatgaatggacatcgggatatgaatttatgcgttctcgattgccg
gttgtattgggacacgagttttcaggaaagatcgcagctgtaggagacgacgtggtcggc
ctacgagtgggtgattcggtggttgtgatgccgggcatcagttgcatgcgttgcgtgacc
tgcgcgcgtggcacaccgcatttgtgcccgaacaaagagacgttggggctgactcgggac
ggtgcatttgccagtcatgtacgtgtgcccgcatcgggttgcatacctattccagcggaa
acggatttgtcgctggcggcgctgaccgaaccactgtgtgtgggcgacaacgcctgcgac
gtagggcaagtaactgctggcgacactgtagtcgtgcttgggcccggaaccatcggacag
gcaattgtgcgcgcggcacgttggaggggggccagtcgtgtcattgctgtcggcatgaac
gacgctgccaggcttgaggttgcacaagcaatgggcgcaacgcattgcattgatctggca
gacggcatctctttgcagcaaggtattcatcgtattacaggtggcaaacctgctgacgtt
gtgattgaagctactggacacgcatccagcatcacggaagggctccagattttgcgtaaa
ggtggcattcttgctgctgcaggtatacacgcccagcgtgcatccttcgatttgacggag
atgatccgcaacaagcagcaaatacgtggtgcgcatggttcgcgccgccagaattgggag
cgcataatcgatcgcatcgttcacgaaccggaatcagtacggcccatgatatctatggag
ttgaaaattaatgatgcggagcaaggcttccgccagtgtcttgcgcgctcggtgtccaag
gttattctacggccagactaa

DBGET integrated database retrieval system