KEGG   Advenella kashmirensis: TKWG_16020Help
Entry
TKWG_16020        CDS       T02117                                 

Definition
(GenBank) ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
aka  Advenella kashmirensis
Pathway
aka00630  Glyoxylate and dicarboxylate metabolism
aka00710  Carbon fixation in photosynthetic organisms
aka01100  Metabolic pathways
aka01120  Microbial metabolism in diverse environments
aka01200  Carbon metabolism
Module
aka_M00165  Reductive pentose phosphate cycle (Calvin cycle)
aka_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:aka00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TKWG_16020
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TKWG_16020
Enzymes [BR:aka01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     TKWG_16020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AFK63175
UniProt: I3UDT7
LinkDB All DBs
Position
2760833..2761252
Genome map
AA seq 139 aa AA seqDB search
MRITQGTFSFLPDLTNEQITKQLQYCLDNGWAVGIEYTDDPHPRNTFWEMFGNPMFDLRD
AAGILQEIEQARNTFPNHYIRVTAFDSTHTVESVVMSFIVNRPAHEPGFRLVRQEIDGRR
MRYTIESYAVAAAPEGSRY
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattacacaaggcaccttctcgtttctacctgatctgaccaacgaacagatcacc
aaacaactgcagtattgcctggacaacggctgggccgtcggcattgaatataccgatgat
ccgcatccgcgcaacactttctgggaaatgttcggcaatcccatgttcgatctgcgcgat
gccgccggcatattgcaggagatcgaacaggcacgcaataccttccccaatcactatatc
cgggtcaccgcgttcgattccactcataccgtagagtctgtggtgatgtcattcatcgtc
aaccgtcccgcccatgaaccaggctttcgtctggttcgccaggaaatcgacggacgacgc
atgcgctacacgattgaaagctatgccgttgcggcagctccagaaggcagccgctattga

DBGET integrated database retrieval system