KEGG   Advenella kashmirensis: TKWG_17450Help
Entry
TKWG_17450        CDS       T02117                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
aka  Advenella kashmirensis
Pathway
aka00071  Fatty acid degradation
aka00362  Benzoate degradation
aka00650  Butanoate metabolism
aka01100  Metabolic pathways
aka01120  Microbial metabolism in diverse environments
aka01200  Carbon metabolism
aka01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aka00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    TKWG_17450
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TKWG_17450
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TKWG_17450
Enzymes [BR:aka01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     TKWG_17450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 NAD_binding_2 Methyltransf_11 Peptidase_S49 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: AFK63395
UniProt: I3UEF7
LinkDB All DBs
Position
complement(3009101..3010852)
Genome map
AA seq 583 aa AA seqDB search
MDHAFYEEKDGIAVITFNNPPVNGLGHGLRKAIVEGVDRANNNSAVRAIVLGGSERAFSG
GADVTEFGTPKASQAPTLRTVIEVLEQSAKPVVAAINGVCLGGGLELALGAHYRVAAAAA
RVGLPEVKLGILPGAGGTQRLPRVVGLEKALNMIVSGQVVKAATLADTALFDKVVDADPQ
AAAIEFAKGLASDAPLKRIRDLAVADADADALLLNARNAAKAGSARFPAPAACVEAVAAS
THMAFDDGLACERHLFTQLMASPESLALRHVFAAERAATKIPDVPADTPLRPIGLVGVIG
AGTMGGGISMNYLNAGIPVILLEQKEEALQRGVATIRKNYENTMKKGRITAEQVEERMKL
LSTTLSYDALGEVDLVIEAVFEDMGVKEVVFRELDRVIKPGAILASNTSTLDVDQIASFT
KRPQDVIGLHFFSPANVMKLLEIVRGAKTAKDVLATCIDMGKKIGKKPVVSGVCDGFIGN
RMLYAYRDAADEVMLQAPRRRRSTARWKISVLQWDLIGWAIWPDWTLAGQSASARRKPIR
KHMKRSWPIACARPAVLARKQVRAGIVMWLAIASRRLTPRSKN
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgctttttacgaagaaaaggacgggattgccgtcattacattcaataacccg
ccggtcaacggcctggggcatggtttgcgcaaagccattgttgaaggcgtcgatcgcgcc
aacaataattcggccgtccgggctatcgtattgggtggatccgagagggctttttccggc
ggcgcagatgtgaccgaattcggtacacccaaggcatcgcaggcacccactttgcgcacg
gtcatcgaagtactggagcaatcggccaagcctgtcgtggctgccatcaatggtgtgtgt
cttggcggcgggctggagcttgcgcttggcgcacactatcgcgttgctgcggccgcggcc
cgagtcggtttacctgaagtcaagcttggcattctgcctggtgcgggcggcacccaacgc
ctgccgcgggtcgtgggactggaaaaggcgctgaacatgattgtgtccggtcaggtcgtc
aaagctgcgacgcttgccgatactgcgctgtttgataaagtggttgacgcagatccccaa
gcggcagccattgaatttgccaaaggtctggccagcgatgcgccgctcaagcggattcgc
gatctggcggttgccgatgcggatgctgacgccttgttgcttaacgcccgtaatgcggcc
aaggcaggctctgcgcgctttccggcgcccgccgcctgcgttgaggcagtggcggccagt
acgcacatggcttttgacgacgggctggcatgtgagcgccatctctttacgcaattgatg
gcctcgcccgaatcactggcgcttcgtcatgtgtttgcggccgaacgcgcagcgacaaaa
attcctgatgtgccggccgataccccgttgcgtccgattggcctggtcggcgtgatcggc
gccggcaccatgggcggcggcatcagcatgaactatctgaatgccggtatcccggtgatt
ctgcttgagcagaaggaagaagcgctgcagcgcggcgtggccaccattcgcaagaactac
gaaaacaccatgaaaaaagggcggattacggcagagcaggtggaagagcgcatgaagctg
ctcagcacgacgctgtcttatgacgcattgggcgaagtcgacctggtcattgaagccgtc
tttgaagacatgggtgtcaaagaggtcgtgttccgcgaacttgatcgtgtcatcaaaccc
ggtgcgattctggcctccaatacgtccaccctggatgttgaccagatcgcttcgtttacc
aagcgcccgcaagacgtgatcggactgcattttttcagtccggccaatgtcatgaagctg
ctggaaatcgtgcgaggtgcaaaaacagccaaggatgtgctggccacgtgtatcgatatg
ggcaaaaaaatcggcaagaaaccggtggtctcaggcgtgtgtgacgggtttatcggcaac
cgtatgctgtatgcctatcgcgatgcggctgacgaggtaatgctgcaggcgccgcgccgt
cgcagatcgaccgcgcgctggaaaatttcggttttgcaatgggaccttatcgggtgggcg
atctggccggactggacattggctgggcaatccgcaagcgcaagaaggaagccgatccgc
aagcatatgaagaggtcgtggccgatcgcctgtgcgaggccggccgttttggccagaaaa
caggtgcgggctggtatcgttatgtggctggcgatcgcaagccgcaggttgaccccgagg
tcgaaaaactga

DBGET integrated database retrieval system