KEGG   Advenella kashmirensis: TKWG_18515Help
Entry
TKWG_18515        CDS       T02117                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
aka  Advenella kashmirensis
Brite
Enzymes [BR:aka01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TKWG_18515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu FmdA_AmdA
Motif
Other DBs
NCBI-ProteinID: AFK63561
UniProt: I3UEX3
LinkDB All DBs
Position
complement(3185964..3186497)
Genome map
AA seq 177 aa AA seqDB search
MKLEKLLLAGMLCTGMISTAGAAELKVTMNEATTSGTGKAMGEVTISETPFGLLLTPDLK
GLAPGVHGFHVHENASCDAAEKDGKTVPAQAAGGHLDPKKTGKHEGPYSEQGHLGDLPGL
VVAADGTSTYPVLAPRLKALSDVQQHALMIHEGGDNYSDHPKPLGGGGGRMVCGVIK
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaaattggaaaaattgttactggcaggcatgttatgtacaggaatgatatccacagca
ggtgcggccgaactgaaagtgactatgaatgaggccactacgtcgggaacgggcaaggca
atgggcgaggtgaccatcagcgagaccccttttggtttgctcttgacgcctgatctcaaa
ggacttgcgcctggcgtgcacggttttcacgttcacgagaatgccagttgtgatgctgct
gaaaaagacggcaaaacggtgccggcccaggctgccggtggccatttggatccgaagaaa
acgggcaagcatgaaggaccatatagtgagcagggccatttgggtgacctgccgggactg
gttgtcgccgccgatggcacatcgacatacccggtgttggctccaaggctcaaagccttg
tccgatgtgcagcagcatgcactcatgattcatgaaggcggcgataactattcagaccat
cccaaaccactcggcggcgggggcgggcgcatggtatgcggtgtgattaaatag

DBGET integrated database retrieval system