KEGG   Acinetobacter larvae: BFG52_10655Help
Entry
BFG52_10655       CDS       T04708                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ala  Acinetobacter larvae
Brite
KEGG Orthology (KO) [BR:ala00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BFG52_10655
Enzymes [BR:ala01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BFG52_10655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored FAD_binding_3 HI0933_like DAO Thi4 NAD_binding_7 NAD_binding_8 K_oxygenase FMO-like Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AOA58762
UniProt: A0A1B2M0N9
LinkDB All DBs
Position
2373073..2374641
Genome map
AA seq 522 aa AA seqDB search
MLDQNIKAQLKTYLERLESPIELIASLDDSQKSDQIKELVTEIAELSDLVTARFDGQNSR
RPSFGIAKAGEAARVFFAGLPMGHEFTSLILALLQVSGYAPKISDEVLQQIKDLNISQNF
EVFVSLSCHNCPDVVQALNLIAIYNPGSSATMIDGAFFQDEVEQRKIMAVPMLFQEGEHI
GQGRMTLEEIIAKLDTGAAAKDAARLNAKQAFDVLVVGGGPAGATAAMYAARKGIRTGIV
AERFGGQVMDTMDIENFISVLKTQGPTFGSSMEQHVRHYEVDIMNLQKVQTITGADQSAS
GLVELELENGAKLSSKTVILSTGARWREMNIPGEQEYRTRGVAYCPHCDGPLFKGKKVAV
VGGGNSGVEAAIDLAGIVEHVTLVEFGDELRADQVLQNKLRSLPNVSIIVSALSTEVLGD
GSQVTGLKYQDRKTQQEHTLELAGIFVQIGLLPNTEFLQGQVELSNRGEIVVNDRNETNI
KGVFAAGDCTTVPYKQIIIAAGEGAKASLSAFDYIIRSGHQD
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccaaaacatcaaagcacaactcaaaacttacttagaacgtttagaaagccca
atcgaattgattgctagcttggatgactcgcaaaaatctgatcaaatcaaagagctagtc
accgaaattgctgagttatctgatttggtaacggcacgctttgatggacaaaacagtcgt
cgtccaagttttgggattgccaaagctggtgaagccgctcgggtattctttgctgggctt
cctatgggacatgagttcacctcattgatcttggcactattacaagtatcgggttatgca
ccgaaaatttctgatgaagtattacaacaaattaaagatttaaatatctcacagaacttt
gaagtctttgtatcgttaagctgtcataactgccctgatgtggtacaagccttgaacctg
attgccatttataatccaggtagtagcgctaccatgattgatggtgcattcttccaagat
gaagtagaacaacgcaaaatcatggctgtgccaatgttattccaagagggtgaacacatt
ggtcaaggtcgtatgactttagaagaaatcattgctaaattggatacgggtgcggctgca
aaagatgctgctcgtctcaatgccaaacaagcatttgatgtcttagtggtcggcggtgga
cctgcgggtgcaactgctgcaatgtatgcggcacgtaaaggaattcgtacaggtatcgtg
gctgaacgttttggtgggcaagtcatggacaccatggacattgagaactttatttctgta
ctcaaaactcaaggtccaacttttggtagcagtatggaacaacatgttcgccactatgaa
gttgacatcatgaacttacaaaaagtgcaaaccattactggtgcagatcaatctgcttca
ggcttggttgaacttgaattggaaaatggtgcaaaactgagctctaaaacagtcatctta
tcaactggcgcacgctggagagagatgaacattccgggtgagcaagaatatcgtacccgt
ggcgttgcatattgcccacactgtgatggtccgttatttaaaggtaaaaaagttgccgtt
gtcggtggtggtaactctggtgtcgaagcggctattgatcttgcaggaattgtagaacat
gtaactttggtcgagtttggtgatgaactgcgtgctgaccaagtattacaaaacaaattg
cgtagcttacccaatgtcagcattatcgtcagtgcgctgtcaactgaagtcttgggcgat
ggcagccaagtcactggtttaaaataccaagatcgcaaaacacagcaagagcatacactt
gagctagctgggatctttgtacaaattggtttattgcccaataccgaatttttgcaaggg
caagttgaattgagcaatcgtggtgaaattgtggtgaatgatcgcaatgaaaccaatata
aaaggtgtgtttgctgcaggtgactgtacaactgttccgtataaacaaatcatcattgcc
gctggtgaaggtgccaaagcatcactttctgcatttgattatattattcgttcaggtcac
caagactaa

DBGET integrated database retrieval system