KEGG   Acinetobacter larvae: BFG52_11870Help
Entry
BFG52_11870       CDS       T04708                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ala  Acinetobacter larvae
Pathway
ala00550  Peptidoglycan biosynthesis
ala01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ala00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BFG52_11870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ala01002]
    BFG52_11870
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ala01011]
    BFG52_11870
Enzymes [BR:ala01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BFG52_11870
Peptidases [BR:ala01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   BFG52_11870
Peptidoglycan biosynthesis and degradation proteins [BR:ala01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   BFG52_11870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AOA58978
UniProt: A0A1B2M1B5
LinkDB All DBs
Position
2647569..2648717
Genome map
AA seq 382 aa AA seqDB search
MIRKSAIAAILLLPTLSNAATVLSNPPELNNKSYILMDYETGQILAAKNENEKLAPASMT
KMMTSYIIEQKLLKGELTETEKVRMNESAWCRGSSAESCMYVDLNKTASVLEMLRGIIVQ
SGNDASKAMAEHISGNEGAFAYMMNQEAKRIGMTNTNFINSTGMPAEGHYSTAKDMALLA
KHIIHDSSKYYPIYSEKEYTYNNIKQGNRNALLYTDPSVDGLKTGHTNEAGFCVTTSAKR
GPIRLISVVFGAPTIQQRATQTRELLAWGFSNFETINVHPAKQVLANAKVWFGDTDEVKV
GLAESFNVTMPKGQGNAIKTQISVQPNLNAPLKQGQVIGKLTATLDGKVIAEKSLVALNE
VEEAGFFSRLIDHIKLFFSNLF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgatccgaaaaagcgccattgctgcgatactgctattaccgaccttatccaatgcagca
accgtactctccaatccaccggaactgaataataaatcatatattctgatggactatgaa
accggacagattttggctgccaaaaatgaaaatgaaaaactggcaccagcatcaatgacc
aaaatgatgaccagttacatcattgagcaaaaactgcttaaaggtgaactgacggaaaca
gaaaaagtccgtatgaatgagtcggcatggtgtcgtggtagtagtgctgaatcgtgtatg
tatgtcgatctcaataaaaccgctagcgtcttagaaatgttgcgcgggattattgttcag
tctggtaatgatgcatctaaagcaatggcggagcatatttcagggaatgaaggtgctttt
gcttatatgatgaaccaagaagcaaaacgcattggcatgaccaataccaattttattaac
tcaactggtatgccagctgaagggcattattcaacagccaaagatatggccctgttggca
aaacatattattcatgacagctctaaatactatccaatttactccgaaaaagaatatacc
tataacaacattaaacaaggcaaccgtaatgccctactttataccgacccaagtgtagat
ggtttaaaaaccggtcataccaatgaagcggggttctgtgtaaccacctcggcaaaacgt
ggtcctattcgtttgatctcggtggtatttggtgcaccaaccattcaacaacgtgcgacc
caaacccgtgaattactggcttgggggttctctaactttgaaaccatcaatgtccaccca
gcaaaacaggttcttgccaatgccaaagtttggtttggtgataccgatgaagtgaaggtt
ggtttagcagaaagttttaatgtcaccatgcccaaaggacaaggtaacgccattaaaacg
caaatttcagtacaacccaatctcaatgcaccactcaaacaaggacaagtgattggtaag
ctgacggcaacactagatggtaaagtcattgcagaaaaatcattggttgcgctcaatgag
gttgaagaggccggatttttctctcgtttaatcgatcacatcaaactattctttagtaat
ttattttaa

DBGET integrated database retrieval system