KEGG   Acinetobacter larvae: BFG52_11955Help
Entry
BFG52_11955       CDS       T04708                                 

Definition
(GenBank) diaminobutyrate--2-oxoglutarate transaminase
  KO
K00836  diaminobutyrate-2-oxoglutarate transaminase [EC:2.6.1.76]
Organism
ala  Acinetobacter larvae
Pathway
ala00260  Glycine, serine and threonine metabolism
ala01100  Metabolic pathways
ala01120  Microbial metabolism in diverse environments
ala01210  2-Oxocarboxylic acid metabolism
ala01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ala00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BFG52_11955
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ala01007]
    BFG52_11955
Enzymes [BR:ala01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.76  diaminobutyrate---2-oxoglutarate transaminase
     BFG52_11955
Amino acid related enzymes [BR:ala01007]
 Aminotransferase (transaminase)
  Class III
   BFG52_11955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AOA58993
UniProt: A0A1B2M1U6
LinkDB All DBs
Position
complement(2668146..2669519)
Genome map
AA seq 457 aa AA seqDB search
MSVSSVNSATLSSNEYYLTRQSQMESNVRSYPRKLPLAIATAKGCWVTDVEGTQYLDCLA
GAGTLALGHNHPAVIQSIQDTLTSGVPLHTLDLTTPLKDAFTEALLAYLPGGQQQYCLQF
CGPSGADATEAAIKLAKTYTGRSSVISFSGGYHGMTHGSLAMTGNLSAKNAVNNLMPGVQ
FMPYPHPYRCPLGLGGEAGVDALTYYFEQFIEDVESGVTKPAAVILEAIQGEGGVVVAPE
KWLRKIREVTEKHNIVLILDEVQAGFSRSGKMFAFEYAGIEPDVVVMSKAVGGSLPLAVL
GIKRKFDAWQPAGHTGTFRGNQLAMGTGLATLKVIKEQKLAENAQQRGDYLQAELSKLAE
QYPCIGHVRGRGLMIGIEIVDERQAPNHIGAYPADAQLAAAIQSACFDNKLLLEKGGRNG
TVIRLLCPLIITQEECVEVIARFKTAIAEALQAVRGV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtttcttctgtaaattctgccaccctttcttctaacgaatattatttgactcgc
caaagtcaaatggaatcaaatgttcgtagttatccacgtaaattaccgttagcgatagcg
acagcaaagggttgctgggttaccgatgttgaaggtacacagtacctcgattgtttggct
ggcgccggtacattagccttgggacataatcaccctgcggtgattcaaagtatccaagat
accttaaccagtggtgttcctttacatacgcttgatttgactacaccgttaaaagatgcg
tttaccgaggctttactcgcgtatcttccaggtggtcaacagcagtattgtttacagttc
tgtggtccatctggtgcagatgccacagaagccgcaattaaattagccaagacctataca
ggtcgttcttctgttattagtttctcaggtggctatcatggcatgacccatggttcactc
gcgatgacagggaatttaagtgccaaaaatgcggtgaataatttaatgcctggtgtacag
tttatgccttacccacatccttatcgttgcccattgggtctcggtggcgaagcgggtgtt
gacgcattaacgtattattttgaacaatttattgaagatgttgaaagtggtgtaaccaaa
ccagccgcggtgattcttgaagcgattcaaggtgaaggcggtgttgtggtcgcaccggaa
aaatggttgcgtaaaattcgtgaagtgaccgaaaaacacaatattgtgttgatcttagat
gaagtacaagctggtttttcacgttcaggtaaaatgtttgcttttgaatatgcagggatt
gaaccggatgtcgtggtgatgtctaaagccgtgggcggcagcttgccattggcggtcttg
gggatcaaacgtaagtttgatgcttggcagcctgcaggtcacactggaactttccgtggt
aaccaattggccatgggcactggacttgccactttaaaggttattaaagagcaaaagctg
gccgagaatgcacaacaacgtggtgattatttacaagctgagttaagcaaacttgctgaa
caatatccttgtattggtcatgtgcgtggtcgtggtttgatgatcgggattgagattgtg
gatgagcgtcaagcgcccaatcatatcggggcttatccagccgatgcacagttggctgct
gcgattcaaagtgcttgttttgacaataagttattgttagaaaaaggtggccgtaacggt
actgtgattcgtttactgtgcccactgattattacccaagaagaatgtgttgaagtgatt
gcacgttttaaaactgcaattgctgaagcattacaggcagtacggggcgtataa

DBGET integrated database retrieval system