KEGG   Acinetobacter larvae: BFG52_12845Help
Entry
BFG52_12845       CDS       T04708                                 

Definition
(GenBank) acetyl-CoA carboxylase carboxyltransferase subunit alpha
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
ala  Acinetobacter larvae
Pathway
ala00061  Fatty acid biosynthesis
ala00620  Pyruvate metabolism
ala00640  Propanoate metabolism
ala01100  Metabolic pathways
ala01110  Biosynthesis of secondary metabolites
ala01120  Microbial metabolism in diverse environments
ala01130  Biosynthesis of antibiotics
ala01200  Carbon metabolism
ala01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ala00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BFG52_12845
   00640 Propanoate metabolism
    BFG52_12845
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BFG52_12845
Enzymes [BR:ala01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     BFG52_12845
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BFG52_12845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACCA Carboxyl_trans ECH_1
Motif
Other DBs
NCBI-ProteinID: AOA59150
UniProt: A0A1B2M1S5
LinkDB All DBs
Position
complement(2884135..2884959)
Genome map
AA seq 274 aa AA seqDB search
MKNKAAQSIAWKTVQIARHPDRPQFLDYVGEIFTEFDALHGDRLYGDDGAMIGGLARFDG
QPVMVIGQHRGRSTREKLQHNFGMCNPEGYRKSQRLFAMAERFKLPIFTFVDTMGAYPGV
GAEERGQAEAIAVNLAQMSSLKVPVITTVLGEGGSGGAIGIAVADHVVMLSHSIYSVISP
EGCASILWKTAEKAEQASEALALTADKLKKIGIVDYVVDEGEGAHLHPEQVMQQLKQVLK
QSLEQLQPMDEKQRCEARYQRLMKFGSNNLGLAS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaagctgctcaatctatagcatggaaaacggttcaaattgcacgtcaccca
gatcgtccgcaatttttggattacgtaggtgaaatttttactgaatttgatgccttacat
ggcgaccgcttatatggtgatgatggtgcaatgattggtgggttggcgcgctttgatggt
caaccggtcatggtcattgggcaacaccgtggacgtagtacacgtgagaaattgcagcac
aattttggcatgtgtaatccagaaggctatcgtaaatcgcaacgtttatttgcgatggca
gaacgttttaaactgccaatttttacctttgtcgataccatgggggcttatcctggcgtg
ggcgcagaagaacgtggtcaagctgaggcgattgcggtcaatttggcacagatgtcgagc
ttaaaagtacctgttatcacaacggtattgggtgagggtggctctggtggtgctattggg
attgcagttgctgaccatgtggtgatgttgtcacatagtatctattcggtaatctcacca
gaaggttgcgcttctattttatggaaaacagcagaaaaagcggaacaagccagtgaagca
ttggcactaactgctgataaactgaaaaaaatcggtatagttgactatgtggtggatgaa
ggcgagggtgctcatcttcatccagaacaagtgatgcaacaattgaaacaagttttgaag
caatcacttgagcaattacaaccgatggatgaaaagcaacgatgcgaggcacgttatcaa
cgtttgatgaagtttggcagcaacaatttagggctcgcctcttag

DBGET integrated database retrieval system