KEGG   Acinetobacter larvae: BFG52_13475Help
Entry
BFG52_13475       CDS       T04708                                 

Definition
(GenBank) bifunctional ornithine acetyltransferase/N-acetylglutamate synthase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
ala  Acinetobacter larvae
Pathway
ala00220  Arginine biosynthesis
ala01100  Metabolic pathways
ala01110  Biosynthesis of secondary metabolites
ala01130  Biosynthesis of antibiotics
ala01210  2-Oxocarboxylic acid metabolism
ala01230  Biosynthesis of amino acids
Module
ala_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:ala00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BFG52_13475
Enzymes [BR:ala01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     BFG52_13475
    2.3.1.35  glutamate N-acetyltransferase
     BFG52_13475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ CbiD
Motif
Other DBs
NCBI-ProteinID: AOA59262
UniProt: A0A1B2M250
LinkDB All DBs
Position
complement(3021269..3022489)
Genome map
AA seq 406 aa AA seqDB search
MAVGDVSMPQMHVVQGVKLSAVEAYIRYPNRRDLVLLQFAADTQVAGVFTQNAFCAAPVT
VSKMHLEQSNPRYLLINTGNANAGTGPQGLSNAQQSCLKLSELAAVEMAQVLPFSTGVIG
EQLPIQRLIDGLPQALAALRDDAWVDAAAGIMTTDTTPKGASEQFECDGIVYSMTGISKG
AGMIRPNMATMLAFVATDFPISAEILQQLLTRTVNRSFNRITIDGDTSTNDSCILAATGQ
AGGACLENLDDPRYGVVAEVLERVMTRLAQLIVRDGEGATKFITVTVEGGAHTQECCDVA
YSIAHSPLVKTALFASDPNWGRILCAIGYAGVVDLDVNKVQVWLDDVQICKDGGAAEDYT
EAAGVAVMQRPEMTIRVDLGRGVAKDTVYTCDLSYDYVKINADYRS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcagttggtgacgtctcaatgccacagatgcatgtggttcaaggggtaaaattaagc
gcagtggaagcatatattcgttatcccaaccgacgtgatttagtattattgcaatttgca
gcagatactcaagtggctggtgtttttacgcaaaatgctttttgtgcagcacctgtcaca
gtgtctaaaatgcatctagaacaaagtaacccgcgctatttgctgattaatacaggcaat
gccaatgctggtacgggaccgcaaggcttaagcaatgcgcagcaaagctgtttgaagcta
tcagagctggcagcagttgagatggcgcaggtattgccattttcaacaggggtcattggt
gagcaattacccattcaacgtttaatcgatggcttaccgcaggcgcttgcggctttgcgt
gatgatgcgtgggtggatgccgcggcaggaattatgaccaccgataccacgcctaaaggt
gcttcagaacaattcgaatgtgatggtattgtctatagcatgacgggtatttctaaaggt
gcaggcatgattcgtcccaatatggcgaccatgttagcttttgttgccacggatttcccg
atatctgctgagatattgcaacagctattgacgcggacagtgaatcgctcatttaaccgt
attacgattgatggtgatacctcgaccaatgattcttgcattctagcggcaacaggtcag
gcgggtggggcttgtctagaaaatctggatgatccacgttatggcgtggttgccgaggta
ttagagcgcgtcatgacgcgtctggcacagttaattgtgcgtgatggtgaaggcgcgact
aaattcatcaccgttactgtagaaggcggtgcacatacacaagaatgttgtgatgttgcc
tatagtattgcgcattctcccttggttaaaactgctttatttgcttcagaccccaattgg
gggcgtatcctttgtgccatcggctatgctggtgtggttgatttagacgtcaataaagtt
caggtttggttggatgatgtacaaatctgtaaggatggtggtgcagctgaagattatacc
gaagcggcaggtgtggctgtgatgcaaaggccagaaatgaccatccgtgtagatctcggg
cgaggcgtggcgaaagataccgtgtatacttgtgacttatcttatgactatgtcaagata
aacgcagattatcgttcataa

DBGET integrated database retrieval system