KEGG   Acinetobacter larvae: BFG52_14215Help
Entry
BFG52_14215       CDS       T04708                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
ala  Acinetobacter larvae
Pathway
ala00020  Citrate cycle (TCA cycle)
ala00270  Cysteine and methionine metabolism
ala00620  Pyruvate metabolism
ala00630  Glyoxylate and dicarboxylate metabolism
ala00680  Methane metabolism
ala01100  Metabolic pathways
ala01110  Biosynthesis of secondary metabolites
ala01120  Microbial metabolism in diverse environments
ala01130  Biosynthesis of antibiotics
ala01200  Carbon metabolism
Module
ala_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ala_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ala_M00012  Glyoxylate cycle
ala_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ala00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BFG52_14215
   00620 Pyruvate metabolism
    BFG52_14215
   00630 Glyoxylate and dicarboxylate metabolism
    BFG52_14215
  09102 Energy metabolism
   00680 Methane metabolism
    BFG52_14215
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BFG52_14215
Enzymes [BR:ala01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     BFG52_14215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: AOA59390
UniProt: A0A1B2M2G9
LinkDB All DBs
Position
complement(3217427..3218413)
Genome map
AA seq 328 aa AA seqDB search
MKQPVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILQMLEIPVEKAQQALKGVMMELE
DCAFPLLAGMVGTDDPNVAFKDADYCLLVGARPRGPGMERADLLQENAKIFTVQGKAIND
HASRDVKVLVVGNPANTNAYIAMKSAPDLNPGQFTAMLRLDHNRALSQIAAKTGKAVKDI
KNLIVWGNHSPTMYADYRFATINGENVKDMINDQEWNENVFLPTVGKRGAAIIEARGLSS
AASAANAAIDHMRDWALGTNGEWVTMGIPSDGSYGIPEGVIYGVPVTCENGQYTRVEGLE
IDEFSRKCMDKTLNELEEERAAIAHLFN
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaacccgttcgtgttgccgtcactggcgctgcaggtcaaattggttatagcttg
ttattccgtatcgcaagcggcgaaatgttagggaaagatcaaccagttattttgcaaatg
cttgaaatcccagttgagaaagctcaacaagcgcttaaaggcgtgatgatggaacttgaa
gattgtgcattcccacttttagcgggtatggttggtacagacgatccaaatgttgcattt
aaagatgcagactactgcttattggttggtgcacgtccacgtggtcctggtatggaacgt
gctgatttgctacaagaaaatgctaaaattttcaccgttcaaggtaaagcaatcaatgat
cacgccagtcgtgatgtcaaagtattagtcgttggtaaccctgcaaataccaatgcttat
attgcgatgaaatctgcaccagatctaaaccctggccaattcactgcaatgcttcgttta
gaccacaaccgtgcgttaagtcaaattgcagcaaaaactggtaaagcagttaaagatatt
aaaaaccttattgtttggggtaaccactctccaaccatgtatgcagactaccgttttgca
accattaatggtgaaaacgtaaaagacatgatcaacgatcaagaatggaatgaaaatgta
ttcctgcctaccgttggtaaacgtggtgcggcaattattgaagcacgtggtctatcttca
gcagcttctgctgccaatgctgcgattgatcatatgcgtgattgggcacttggtaccaat
ggcgaatgggtgactatgggtattccatctgatggttcttatggtattcctgaaggcgtt
atttacggtgtacctgtgacttgtgaaaacggtcaatatacccgtgttgaaggcttagaa
atcgatgaattcagccgtaaatgcatggacaaaactttgaatgaacttgaagaagaacgt
gctgcgattgcacatctttttaactaa

DBGET integrated database retrieval system