KEGG   Acinetobacter larvae: BFG52_14765Help
Entry
BFG52_14765       CDS       T04708                                 

Definition
(GenBank) AraC family transcriptional regulator
  KO
K07506  AraC family transcriptional regulator
Organism
ala  Acinetobacter larvae
Brite
KEGG Orthology (KO) [BR:ala00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ala03000]
    BFG52_14765
Transcription factors [BR:ala03000]
 Prokaryotic Type
  Helix-turn-helix
   AraC family
    BFG52_14765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC LAMTOR
Motif
Other DBs
NCBI-ProteinID: AOA59484
UniProt: A0A1B2M2S0
LinkDB All DBs
Position
complement(3323889..3324764)
Genome map
AA seq 291 aa AA seqDB search
MAYQILEQLQQYKAQLLDSVELGSGMQLAMWQNNQDRVSVCSDHHTLSLYIQGGYHSYQK
TAQGWHNGGGPDRMCLMPQDFESTWDLRDPLTFVHLYYTKQHLQRIAQQVWDREPSQIIL
NPQIFVADPQIAIIYRHFLLNTAWHYHENHLQMSTATTLLLNHLIQNYSAVQWQAPEIKG
GLSPYVLKHLLEWIDQHIQQSLTLSDLAQQTQLSEYHFAHMFKQSMQIPPHQYVMQRRLE
LAHQALQQTSAHIIDISEQYGFSSSSHFSNRFKKQFGYSPSQIRKSGKSSR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcagattctagaacagttgcaacagtataaagctcaactgcttgattcggtt
gagttaggttctggtatgcaactcgccatgtggcaaaataatcaagaccgcgtcagtgtc
tgcagtgatcaccacacacttagtctatatattcaagggggttatcacagttatcaaaag
actgctcaaggctggcataacgggggtggaccagaccggatgtgtttgatgccgcaagat
tttgagtcgacatgggatctacgtgatccgcttacttttgtacatctgtattacactaag
caacacctgcaacgcatagctcagcaggtgtgggatcgtgagccgagtcaaattatttta
aatccacaaatttttgtggcagatccacagattgccattatctatcgtcactttctatta
aatacagcttggcactatcatgaaaatcacttgcaaatgagtacagctactacgttattg
ctcaatcatttgattcaaaattatagcgctgtgcagtggcaagcacctgagatcaaaggt
ggcttgtcaccttatgtgcttaaacatttattagaatggattgatcagcatattcagcaa
agtttaactttatcggatttggcgcaacaaacacagctgagtgaatatcattttgcgcat
atgtttaaacaatctatgcagataccaccgcatcaatatgtgatgcaacgccgtcttgaa
ttggcccaccaagctttacaacagacttcagctcatatcattgatatttcagaacaatat
ggcttcagttccagtagtcattttagcaatcgctttaaaaaacaatttgggtattctccg
tctcaaataagaaaaagtggaaaaagtagccgttga

DBGET integrated database retrieval system