KEGG   Altererythrobacter sp. B11: AEB_P1072Help
Entry
AEB_P1072         CDS       T05671                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
alb  Altererythrobacter sp. B11
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BBC71940
UniProt: A0A2Z5YVA1
LinkDB All DBs
Position
1114230..1115702
Genome map
AA seq 490 aa AA seqDB search
MTPQGVTIKHPDRLFIGGEWVAPAAGGTIEIVNPASEEVVARTAAAGPADMDHAVAAARQ
AFDHGPWPTTPPAERGAALNRMIDILEARVPELAAAWTAQVGGLASFAPMMHGGAVAQLR
GIAAMGESFAWVSQKKGQVVDTAVIVREPVGVVVGIAPWNAPFGIMANKVFYALIAGCPI
IMKPSPETPLEAYIIAEAAEAAGLPAGTVNLVPAEREAADHLIHSPDIDKVTFTGSSAAG
MHIASVCGGKMTRCTMELGGKSAAIIRDDFPIEAAAGILGNTITVMSGQVCAMLSRAIVP
RARHDELAEAIAGVMKGIRIGAPEDAETQLGPLAMKRQLERVEMYIEEGRKGGADLVTGG
QRPAHMNKGYYIEPTLFANVDNQSRIAQEEIFGPVLCLIPAEDEEDAIRIANESNFGLNG
SVLTSDPQAAYDISRRIRTGVMGQNGMRMEFGMPFGGFKQSGMGREGGEEGLWPYLETKT
ILLDGAPARV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaccccccaaggcgtgaccatcaagcatcccgaccggctgttcatcggcggcgaatgg
gtcgcccccgccgccggcggaacgatcgagatcgtcaatccggcgagcgaggaggtggtc
gcccgcaccgccgccgccggcccggcggacatggaccacgccgtcgccgccgcgcggcag
gccttcgatcacggcccatggcccaccacgcccccggcggagcgcggcgcggcgctgaac
cggatgatcgacatcctcgaagcgcgcgtgcccgagcttgccgccgcctggacggcgcag
gtcggcggcctcgccagcttcgcgccgatgatgcacggcggcgcggtggctcagctgcgc
ggcatcgccgccatgggcgagagcttcgcctgggtcagccagaagaagggccaggtggtt
gacaccgccgtgatcgtgcgcgagccggtgggcgtcgtcgtcggcatcgcgccgtggaac
gcgcccttcggcatcatggcgaacaaggtgttctacgccctgatcgccggctgcccgatc
atcatgaagccctcgcccgaaaccccgctggaagcctatatcattgccgaggcggcggag
gcggcgggcctgccggcgggcacggtgaacctggtcccggcagagcgcgaggcggccgac
cacctgatccacagcccggatatcgacaaggtcaccttcaccggatcgagcgcggcgggc
atgcatatcgccagcgtctgcggcggcaagatgacccgctgcacgatggagctgggcggc
aagtccgccgccatcatccgcgacgatttcccgatcgaggcggccgcgggcatcctcggc
aatacgatcacggtgatgagcgggcaggtctgcgccatgctcagccgcgccatcgtaccc
agggcccggcatgacgagctggccgaggcgatcgcgggcgtgatgaagggcatccgcatc
ggcgcgccggaggatgcggaaacccagctcggcccgctggcgatgaagcgccagctggaa
cgggtggaaatgtatatcgaggaaggccgcaagggcggcgccgatctcgtcaccggcggc
cagcgcccggcgcatatgaacaagggctattacatcgagcccaccctgttcgccaatgtc
gacaaccagagccgcattgcgcaggaggagatcttcggcccggtgctgtgcctgatcccg
gccgaggacgaggaggatgcgatccgcatcgccaatgagagcaatttcggccttaacggc
tcggtgctcaccagcgacccgcaggccgcctatgacatcagccggcgcatccgcaccggc
gtgatggggcagaacggcatgcgcatggaattcggcatgcccttcggcggcttcaagcaa
tcgggcatgggccgcgaaggcggcgaggaggggctgtggccctatctggaaaccaagacg
atcctgctggacggcgcgccggcgcgggtctga

DBGET integrated database retrieval system