KEGG   Altererythrobacter sp. B11: AEB_P1567Help
Entry
AEB_P1567         CDS       T05671                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
alb  Altererythrobacter sp. B11
Brite
KEGG Orthology (KO) [BR:alb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:alb01002]
    AEB_P1567
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:alb04147]
    AEB_P1567
   04090 CD molecules [BR:alb04090]
    AEB_P1567
Enzymes [BR:alb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     AEB_P1567
Peptidases [BR:alb01002]
 Metallo Peptidases
  Family M2
   AEB_P1567
Exosome [BR:alb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AEB_P1567
CD molecules [BR:alb04090]
 Proteins
  AEB_P1567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: BBC72435
UniProt: A0A2Z5YW70
LinkDB All DBs
Position
1630895..1632742
Genome map
AA seq 615 aa AA seqDB search
MKLLASAALLALAANLATPAFAAEDAPATEAKAEFPMTPQGAADFVAAAEKDLFDYSVDA
SRIAWVNATYITPDTDALAAQSGAVGTEKAVRYALQAARYARVKGLDPDVARKLDILRNG
IVLPAPTTPGAAAELNTIATDLQSQYGKGKGTLDGKAISGSDIEAEMGNLDHTPAEYAEM
WKSWHDNVGAPMKDDYARLVTIANEGAKELGFADAGAMWRSNYDMDPDQFAATTERLWEE
MKPLYLALHTYVRTRLNEKYGDAVQPASGPIRADLLGNMWAQEWGNIYPLVAPPGAGDLG
YDIGDLLKAQGKQPLDMVKTGEGFYSSLGFEKLPETFWERSLFVKPADREVVCHASAWDV
DNKDDIRIKMCIKVNADDFVTIHHELGHNYYQRAYKEQPYLYLNGANDGFHEAIGDFIAL
SITPEYLVQIGLLDRSQVPSADKDIGLLLRQAMDKVAFLPFGLLVDKWRWGVFDGSISPA
QYNTAWVDLKREYQGIVPPVERPADAFDPGAKYHIPGNTPYMRYFLARILQFQFYKAACE
QAGWKGPLHRCSFYGNKQVGEKLNAMLEMGASKPWPEALEVFTGSRELSAKPMLDYFAPL
KKWLDEQNKGKPSGW
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgctcgcctccgccgcgctgctggcgcttgctgccaatcttgccacccccgcc
ttcgccgcggaggatgccccagcgacagaggcgaaggccgagtttccgatgacgccgcag
ggcgcggccgatttcgtggctgcggccgagaaggatttgttcgattactcggtggatgcg
agccgcatcgcctgggtcaacgccacctatatcaccccggataccgacgcgctggccgcg
caaagcggcgccgtgggtacggaaaaggcggtgcgctatgcgctgcaggccgcccgctac
gcccgcgtgaagggtctcgatccggatgtggcgcgcaagctcgatatcctgcgcaacggc
atcgtgctgccggccccgaccacgcccggtgcagcggcggagctgaacacgatcgccacc
gatctccagtcgcaatacggcaagggcaagggcacgctcgatggcaaggcgatctccggc
tccgacatcgaggcggagatgggcaatctcgatcatacgccggccgaatacgccgaaatg
tggaagagctggcacgacaatgtcggcgcgccgatgaaggacgattacgcacggctggtg
accatcgccaacgaaggcgcgaaggaactgggctttgccgatgcgggcgccatgtggcgg
tccaattacgacatggacccggatcaattcgccgccacgacggagcggctgtgggaggaa
atgaagccgctgtacctggcgctgcacacctatgtccgcacccggctgaacgagaagtat
ggcgatgcggtgcagcccgcctccggcccgatccgcgcggacctgctgggcaatatgtgg
gcgcaggaatggggcaatatctatccgctggtggcgcccccgggggccggcgatctgggc
tatgacatcggcgatctgctgaaggcgcagggcaagcagccgctggacatggtgaagacg
ggggagggcttctattcctcactcggcttcgaaaagctgcccgaaaccttctgggaacgc
agccttttcgtgaagccggccgaccgcgaagtggtctgccacgccagtgcctgggatgtg
gacaacaaggacgatatccgcatcaagatgtgcatcaaggtgaatgccgatgacttcgtg
acgatccaccacgagctcggccacaactactatcagcgtgcctacaaggaacagccgtat
ctctatctgaacggcgcgaatgacggattccacgaagccatcggcgatttcatcgccctg
tcgatcaccccggaatatctggtgcagatcggcctgctggaccgttcgcaggtgcccagc
gccgacaaggacatcggcctgctgctgcgccaggcgatggacaaggtggccttcctgccc
ttcggcctgctggtagacaaatggcgctggggggtgttcgacggatcgatcagcccggcg
cagtacaacaccgcctgggtggatctgaagcgcgagtatcagggcatcgtgccgccggtg
gagcggccggcagacgccttcgacccgggcgccaaatatcacattcccggcaacacgccc
tacatgcgctatttcctcgcgcgcatcctccaattccagttctacaaggccgcgtgcgag
caggcgggctggaagggaccgctgcaccgctgcagcttctacggcaacaagcaggtgggc
gagaagctgaacgcgatgctggaaatgggcgccagcaagccctggccggaggcgctggag
gtgttcaccggcagccgcgagctaagcgccaagccgatgctcgactatttcgcgccgctg
aagaagtggctggacgaacagaacaagggcaagcccagcggctggtaa

DBGET integrated database retrieval system