KEGG   Altererythrobacter sp. B11: AEB_P1915Help
Entry
AEB_P1915         CDS       T05671                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
alb  Altererythrobacter sp. B11
Pathway
alb03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:alb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AEB_P1915
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:alb03400]
    AEB_P1915
Enzymes [BR:alb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AEB_P1915
DNA repair and recombination proteins [BR:alb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AEB_P1915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S ActA
Motif
Other DBs
NCBI-ProteinID: BBC72783
UniProt: A0A2Z5YX58
LinkDB All DBs
Position
2002571..2005084
Genome map
AA seq 837 aa AA seqDB search
MSMDPLAEYNRKRDFKKTAEPAGKRARGKAGRRFIVQKHDATRLHWDFRLEVDGVLKSWA
VTKGPSPDPDIKRLAVRTEDHPMAYAEFEGSIPKGEYGGGSVMLWDSGTWAPVEGKSAKD
LEDGHLHFTLDGQRMKGEWLLVRMKPRKGEKRENWLLRKVADDYAQEGDPLVEQGLTSVL
TGRSMAEIAADAGGEHSLKGKKGTTFTQEMEKAASHNRAKAKPHRRSSGKPPAFREPQLA
TLVDAVPAGNRWMHEIKFDGYRALVAAAGDQVKIYTRSGKDWTDKFAPLVRSFAALDLPP
CLIDGEIVAYDKSGNPDFSSLQQVLKRGHGEQGEQDALAFHGFDLLELDGEDLSRLPNIE
RKEKLEALLRSAEPPIHVADHVIGAGEQLFERMCGAGQEGIISKKIDARYGTGRGKSWVK
VKCTRRQEFVIIGWTKSSARARPFASLALAQHEGGKLVYKGRVGTGFNADTLSELSGKFR
SLERKTPPAEVDRTEARGVTWLTPKLVAEVAFAEFTAEGRVRHASFLGLRGDKDAAEVKP
ETAEPAPEETEEEVKITSRERVVYPDAGFTKGDLADYYQRIAPRMLAFAANRPISLVRCP
QGRAKKCFFQKHDTGAFGAHVHHVPIREKGGGSEDYIYIEDVGGILACVQMGTIEFHGWG
SRSMDVEAPDRMIFDLDPDEGLDFEDVKRAAKDIRDRLADLGLTSFAMLSGGKGVHVIVP
LRTGHSWDEHKDFSKRFAEALSMAEPDRFVATMSKAKRKGKIFIDWLRNQRGSTAVLPYS
ARAREGAPVAAPIAWGELGKMKKASAFTIGDADQLLARAGGKGLAGWGFADQALPDF
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggatcccctcgccgaatacaaccgcaagcgggacttcaagaaaacggcggag
ccggcagggaagcgcgccagaggcaaggcggggcgccgcttcatcgtgcagaagcacgat
gcaacgcgcctgcactgggactttcggctggaggtggacggcgtgctgaaaagctgggcc
gtcacaaagggcccctctcccgatccggacatcaagcgcttggccgtgcggacggaggac
catccgatggcctatgccgagttcgagggttcgatcccgaaaggcgaatatggcggcgga
tcggtgatgttgtgggacagcggcacctgggcgccggtggaaggcaagagcgcgaaggat
ctggaagacggccatctgcactttaccctcgacgggcagcgcatgaagggggaatggctg
ctggtgcgcatgaaaccgcgcaaaggcgaaaagcgggagaactggctgctccgcaaggtg
gcggatgattacgctcaggaaggcgatccgctggtggagcagggcctcaccagcgtgctc
accggccgctcgatggccgaaatcgccgccgatgcgggcggcgaacattcgctcaagggc
aagaagggcacgaccttcactcaggagatggagaaggccgcaagccacaaccgcgctaag
gcaaagccgcaccgccgctccagcggcaaaccaccggcatttcgcgaaccgcagctcgcc
acgctggtcgacgctgttccagccggcaaccgctggatgcacgagatcaagttcgatggc
tatcgcgcgttggtcgccgccgccggcgatcaggtgaagatttacacccgcagtgggaag
gactggacggacaaattcgccccgctggtccgcagcttcgccgcgctggacctgccgccg
tgcctgatcgacggcgagatcgtcgcctacgacaaatctggcaaccctgacttctcctcg
cttcagcaggtgctgaagcggggccacggcgagcagggggagcaggatgcgctggccttc
catggtttcgacctgctcgaactggatggggaggatctgtctcgcctgcccaacatcgaa
cgcaaggagaagctggaggcactgcttcgcagtgccgaaccgccgatccatgtcgccgat
cacgtgatcggcgcgggcgagcagctgttcgagcggatgtgcggcgccgggcaggaaggc
atcatctccaagaaaatcgatgcgcgctatggcaccgggcgcggcaagagctgggtgaag
gtgaaatgcacgcggcggcaggaattcgtcatcatcggctggacgaaaagctctgcccgt
gcgcgccctttcgcttccctcgctctcgcccagcatgaaggcggcaagctggtgtacaag
gggcgcgtcggcaccggcttcaacgcggacacgctgagcgagctttccggcaagttccgc
tcgctggaacgcaagacgcccccggcggaggtggacaggacggaagcgcgcggcgtcacg
tggctcacgccaaagctggtggccgaagtggcctttgccgagttcacggcagaagggcgc
gtgcggcacgcgagcttcctcggtctgcgtggagacaaggatgccgctgaggtgaaacca
gagaccgcggagcccgcgcccgaagaaaccgaagaggaggtgaagatcaccagccgcgag
agggtggtctatcccgatgccggctttaccaagggcgacctagcggactactaccagcgg
attgctccgcgcatgctggccttcgcggcgaaccgcccaatcagcctcgtgcggtgcccc
cagggtcgggcaaagaagtgcttcttccagaagcacgataccggtgcgtttggggctcat
gtccaccatgtgccgatccgcgagaagggcggtggctcggaagactacatctatatcgag
gatgtcggcggcatactcgcctgcgttcagatgggcacgatcgagtttcacggctggggc
agccgcagcatggatgtggaggcgccggaccggatgatcttcgacctcgatccggacgag
ggactggatttcgaggacgtgaagcgcgccgcgaaggacatccgggatcggctggccgat
ctgggcctgacgagctttgccatgctatcgggcgggaagggcgtccatgtcattgtcccg
ctgcggaccgggcatagctgggatgaacacaaggatttttcgaaacgcttcgccgaagcc
ttatcgatggcggagcctgaccgcttcgtcgccacgatgagcaaggcgaagaggaaggga
aagatcttcatcgactggctgcgcaaccagcgcggatccaccgccgtgctgccctattcg
gcgcgggcgcgggagggggcgccggtggccgcgccgatcgcctggggtgaattgggcaag
atgaaaaaagccagtgccttcacgatcggtgatgcggatcagttgcttgcccgtgccggc
ggcaagggcctggctggctggggctttgccgatcaggcgctgccggacttctga

DBGET integrated database retrieval system