KEGG   Altererythrobacter sp. B11: AEB_P2910Help
Entry
AEB_P2910         CDS       T05671                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
alb  Altererythrobacter sp. B11
Pathway
alb00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:alb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AEB_P2910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:alb02000]
    AEB_P2910
Enzymes [BR:alb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AEB_P2910
Transporters [BR:alb02000]
 Other Transporters
  Pores ion channels [TC:1]
   AEB_P2910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: BBC73778
UniProt: A0A2Z5Z008
LinkDB All DBs
Position
3070597..3071238
Genome map
AA seq 213 aa AA seqDB search
MAEFTFFTNPMSRGQIARWALHEVGADYEQVLVPWDNRPAALLAINPLGKVPTLIHHAAS
GDRVISEGAAICAYLGDVLPGAGLAPLPEEKADFYRWLFFAAGPIEQGVTARHLGFEPSD
ARQRMTVGFGDLDVALSMLEAHLAGRDWVCGARFNMADVYVGSQVDWGLQFGTFPDTPTF
TAYAERCRAREGYRSAKAVDNALIAEAEGAQKD
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggctgagttcaccttcttcaccaatcccatgtcgcgcgggcagattgcccgctgggcc
ctgcatgaggtcggcgccgattatgagcaggtgctcgtgccgtgggacaaccgcccggcc
gcgctgctggcgatcaatccgctgggcaaggtgcccacgctgatccaccacgcggccagc
ggcgaccgggttatttccgaaggcgcggcgatctgcgcctatctgggcgacgtactgccc
ggcgcagggctggcgccgctgccggaagagaaggccgatttctaccgctggctgttcttc
gccgccgggccgatcgagcagggcgtcacggcccggcacctcggcttcgaacccagcgac
gcgcggcagcggatgacggtgggcttcggcgatctggatgtggcgctgagcatgctggag
gcgcatctggccggccgggactgggtgtgcggcgcgcgcttcaacatggcggacgtctat
gtcggcagccaggtggactggggcctgcagttcgggacttttcccgatacgccaaccttc
accgcctatgccgaaagatgccgcgcccgcgagggctatcggtcagccaaggcggtggat
aatgccctgatcgccgaagccgaaggcgcacagaaggactga

DBGET integrated database retrieval system