KEGG   Altererythrobacter sp. B11: AEB_P3248Help
Entry
AEB_P3248         CDS       T05671                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
alb  Altererythrobacter sp. B11
Pathway
alb00473  D-Alanine metabolism
alb00550  Peptidoglycan biosynthesis
alb01100  Metabolic pathways
alb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:alb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AEB_P3248
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AEB_P3248
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    AEB_P3248
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:alb01011]
    AEB_P3248
Enzymes [BR:alb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AEB_P3248
Peptidoglycan biosynthesis and degradation proteins [BR:alb01011]
 Precursor biosynthesis
  Amino acid ligase
   AEB_P3248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: BBC74116
UniProt: A0A2Z5Z139
LinkDB All DBs
Position
complement(3480276..3481241)
Genome map
AA seq 321 aa AA seqDB search
MNSELPRLHVVVLMGGWANEREVSLMSGKGVADALESRGHRVTRIDMDRDVAARLAEAAP
DVVFNALHGVPGEDGTVQGMMDLMGIPYTHSGLATSVIAIDKELTKHALVPHGIPMPGGR
IVDSEDLYEGDPLPRPYVLKPVNEGSSVGVAIVTAESNYGDPIRRDAAGPWQKFRQLLAE
PYIRGRELTAAVLGDRALMVTELVPKSGFYDFDAKYTDGMTEHVCPAKIPPEIEKLCLDY
ALRAHRLLGCRGTSRSDFRWDDERGEEGLFLLETNTQPGMTPLSLVPEQARHCGIDYADL
VEIIIADALRHFGRLPAGAAG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcgaacttccgcggctgcatgtggtcgtcctcatgggcggctgggccaacgaa
cgcgaagtctcgctgatgagcggcaagggcgtggccgatgcgcttgaatcgcgcggccac
cgcgtcacccggatcgacatggaccgcgatgtcgccgcgcgcctggcggaagccgcgccc
gacgtggtgttcaacgcgctgcacggcgtgccgggggaagatggcacggtgcaggggatg
atggacctgatgggcatcccctatacccattccggcctcgccacctcggtcatcgcgatc
gacaaggaactgaccaagcatgcgctggtgccgcatggcattccgatgccgggcgggcgc
atcgttgacagcgaggatctttacgaaggggatccgctgccccgtccctatgtgctgaag
ccggtcaacgaaggctcatccgtgggcgtggccatcgtgacggcggaaagcaattacggc
gatccgatccggcgggatgccgccgggccgtggcagaagttccgccagctgctggccgaa
ccctatatccgcggccgcgaactcaccgccgccgtgctgggcgatcgggcgctgatggtc
accgaactggtgcccaagagcggcttctacgatttcgacgccaaatacaccgacggcatg
acggagcatgtctgcccggcgaagatcccgccggagatcgaaaagctgtgcctcgattat
gccctgcgcgcccatcgcctgctcggctgtcgcggcacgagccgttcggacttccgctgg
gatgacgagcggggtgaggagggcctgttcctgctggagacgaacacccagccgggcatg
acgccgctcagcctcgtgcccgaacaggcccggcattgcggcatcgactatgccgatctg
gtggagatcatcatcgccgatgcgctgcgccatttcggccggctgcctgcgggagcggca
ggctga

DBGET integrated database retrieval system