KEGG   Acinetobacter lactucae: OTEC02_01535Help
Entry
OTEC02_01535      CDS       T05220                                 

Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
alc  Acinetobacter lactucae
Pathway
alc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
alc01100  Metabolic pathways
alc01110  Biosynthesis of secondary metabolites
alc01130  Biosynthesis of antibiotics
alc01230  Biosynthesis of amino acids
Module
alc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:alc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OTEC02_01535
Enzymes [BR:alc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     OTEC02_01535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 AAA_5 TsaE Cytidylate_kin AAA_22 AAA AAA_16 Cytidylate_kin2 AAA_28 dNK Mg_chelatase CHDNT ABC_tran RNA_helicase Ploopntkinase3 CoaE IstB_IS21 AAA_30
Motif
Other DBs
NCBI-ProteinID: ARD27589
UniProt: A0A1V0K7E5
LinkDB All DBs
Position
318642..319211
Genome map
AA seq 189 aa AA seqDB search
MKAIEIGGALPSKAFETLPNIYLVGPMGAGKTTVGRHLAELLGREFLDSDHEIERKTGAT
IPWIFEKEGEIGFRTRETVVLNELTSRKALVLATGGGAITQAPNREFLKQRGIVVYLYTP
VELQLQRTYRDKNRPLLQVENPEQKLRDLLKIRDPLYREVAHYTIETNQGAARDLAQKIL
QLILSNPLK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaattgaaataggtggcgccttgccaagcaaagcgtttgaaaccctgccaaat
atttatttggtagggcccatgggggcaggaaaaacaaccgttggacgtcatttagccgaa
ctattagggcgtgaatttttagatagcgatcatgaaattgaacgcaaaacaggtgccact
attccctggatttttgagaaagaaggggagattggatttcgtactcgtgaaaccgtagtg
ctaaatgagttgacttcccgtaaggccttagtattagcgacaggaggaggggcgattact
caagcacccaatcgcgaatttctaaagcaacgtggtatagttgtttatctgtacaccccc
gtagaattacaattacaacgaacttatcgtgataaaaacagacctctattacaagttgaa
aaccctgaacaaaaattacgtgatttgttaaaaatacgtgaccctttatatcgtgaagtt
gcgcattacacgattgaaaccaatcagggtgctgctcgtgatcttgctcaaaagattttg
caacttattttgtccaacccgctaaaatag

DBGET integrated database retrieval system