KEGG   Acinetobacter lactucae: OTEC02_05550Help
Entry
OTEC02_05550      CDS       T05220                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
alc  Acinetobacter lactucae
Brite
Enzymes [BR:alc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     OTEC02_05550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ARD28275
UniProt: A0A151YMC8
LinkDB All DBs
Position
complement(1180309..1180935)
Genome map
AA seq 208 aa AA seqDB search
MTTITLPALPYGYDDLAPHISKETLEYHHDKHHNTYVVNLNNLIKGTDLEGKTLEEIIQA
TAGDASKAGIFNNAAQVWNHTFYWNSMKPNGGGKPTGAIAAKIDEAFGSYEKFAEEFTAA
ATTQFGSGWAWLVADEVNGKLSITKTSNADTPLAHGQIAVLTIDVWEHAYYIDFRNLRPK
YIATFLESLVNWDYANAKLAGQPAGVEK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccattactttacctgcacttccatatggctatgatgatttagcgccacatatt
agtaaagaaactttagaataccatcacgataaacaccacaatacctatgttgttaactta
aacaacttaatcaaagggactgaccttgaaggtaaaactttagaagaaatcatccaagca
actgctggtgatgcatctaaagctggtattttcaacaatgctgctcaagtttggaaccat
acattctattggaattcaatgaagccaaacggtggtggtaagcctactggcgcaatcgct
gctaaaattgacgaagcttttggtagctacgaaaaatttgcagaagaatttactgctgct
gcaacaactcaattcggttcaggttgggcttggttagttgctgatgaagtaaacggtaaa
ctttctattactaaaacttctaatgcagacactccacttgcacatggtcaaattgctgta
ttaacaattgacgtatgggaacacgcttactacatcgatttccgtaacttacgtcctaaa
tacatcgcaactttcttagaaagccttgtgaactgggactatgcaaatgcaaaacttgca
ggtcaaccagcaggcgtagagaaataa

DBGET integrated database retrieval system