KEGG   Acinetobacter lactucae: OTEC02_09750Help
Entry
OTEC02_09750      CDS       T05220                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
alc  Acinetobacter lactucae
Pathway
alc00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:alc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    OTEC02_09750
Enzymes [BR:alc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     OTEC02_09750
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     OTEC02_09750
    1.1.1.-  
     OTEC02_09750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Semialdhyde_dh FAD_binding_3 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: ARD29028
UniProt: A0A1V0KBG5
LinkDB All DBs
Position
complement(2071435..2072493)
Genome map
AA seq 352 aa AA seqDB search
MKAARFYDRGDIRIEDIPEPEVTPGTVGIQVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPITMGHEFSGVVYAVGEGVDDIEIGQHVVVEPYIVADDVPTGPGDNYHLSKNMNF
IGLGGRGGGLSEKIAVKRRWVHPISNKIPLDQAALIEPLSVGHHAYVRSGAKAGDIALVG
GAGPIGLLLSAILKAKGLKVIITELSAKRKEKAKESGVADYILDPSEVDVVSEVMKITNG
DGVDVAFECSSVNKVLDTLVAAVKPTGVIVIVSIWSHPASINVHSVVMKELDVRGTIAYV
NDHQETIKLVEEGKINLEPFITQRIQLDDLISQGFETLIHNNESAVKIIVQP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcgcgtttttatgacagaggcgatattcgtattgaagatatccctgaacca
gaagtcactcccggcactgtaggtattcaggtggcttggtgcggaatttgtggtacagat
ttacatgagtttatggaagggccgatttttattccaccgtgtggccatccgcatcctatt
tcaggcgaatcagcaccgattaccatgggacatgagttttcaggtgtggtctatgccgtt
ggtgaaggtgttgatgacattgaaattggtcaacatgtcgtagtagagccttatattgtg
gccgatgatgtgccgactggaccgggcgataattatcatctttctaaaaatatgaacttt
attggtttaggtggtcgtggcggtggtttatccgaaaaaattgcggttaaacgccgttgg
gtgcatccaatttccaataaaattccgctagatcaggcggccttaattgaacctttgtcg
gttggtcatcatgcctatgtgcgtagtggtgcaaaggctggtgatattgcactggtaggt
ggtgcaggccccattggtttgttgctttcggcaattttaaaagccaaaggtcttaaggtc
atcattaccgaactaagtgccaaacgtaaagaaaaagccaaagagtcgggagtcgcagat
tatattttagacccttcagaagttgatgttgtttctgaggtcatgaaaattactaatggc
gatggcgtcgatgtcgcgtttgaatgtagtagcgttaacaaagttttagatactttggtt
gcagcagtcaaaccaacaggcgttatcgttattgtttcgatttggagccacccagcatca
attaatgtgcatagtgtggtgatgaaagagcttgatgtacgcggcacaattgcctatgtg
aatgaccatcaagaaacgattaaactggtcgaagaaggtaaaataaatcttgaacctttt
attacccagcgtattcaacttgatgatttgatttcacaaggttttgaaaccttaattcat
aacaatgagtcagccgttaagattatcgtacagccctaa

DBGET integrated database retrieval system