KEGG   Acinetobacter lactucae: OTEC02_09795Help
Entry
OTEC02_09795      CDS       T05220                                 

Definition
(GenBank) GGDEF domain-containing protein
Organism
alc  Acinetobacter lactucae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF DUF212
Motif
Other DBs
NCBI-ProteinID: ARD29037
UniProt: R8YT79
LinkDB All DBs
Position
2082048..2083277
Genome map
AA seq 409 aa AA seqDB search
MKLQGSNILGQEQIDLLTTRGLNFVWFPKRLETIYRFQYQNGAAYEFRYRAPIILILYIF
LSFGIYQVLPSEQVLPWFSYYSWVGVIVFIAWILSFIKKLNQYFDYYVGIGSALAVAITF
ILINVIENGQENVLFHAAMMYAIVIIYGAVGMRFYTAIFAGWIGGLVGILVSNYLNGVID
WTFLNRTYTFSSFLGMTLAYATDRQHRENYLQNCMIELNRIELMQQAQQLSLLSQQDALT
GLANRRYLDETLDNEWRRALRHETPLTIMMVDIDYFKAYNDTLGHLKGDECLKEIAIAIS
SIAARSGDLVARYGGEEFLLLFPMTNAQQALIQVERLMSAINKIAIKHPCSDVSPYVTIS
VGVATTIPRLNDSISAFVARADHALYKAKTNGRNQYKIAVNEEQIVDLT
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgcaaggttccaatatattgggacaggaacaaatagatttattaaccacacga
ggattaaacttcgtatggtttccaaagcgacttgaaacgatttatcgttttcagtaccaa
aatggtgctgcctatgagttccgctatagagcgcccattattttaatattatatatattt
ttaagctttggtatatatcaagttttaccaagtgaacaagttttgccctggtttagttat
tattcttgggtaggtgtaattgtttttattgcttggattttatcatttattaaaaaactg
aaccaatattttgattattatgtaggaattggctcagctttagcggtagcaattactttt
attttaattaatgttattgaaaatggccaagagaatgttcttttccatgcagcgatgatg
tatgcaatcgttattatttatggtgctgttggtatgcgtttttacaccgccatatttgct
ggatggataggaggactcgttggaattttagtaagtaactacttaaatggggtgattgat
tggacgttcttaaatcgaacttatactttcagtagttttttgggaatgaccctcgcctat
gcaactgaccgtcagcaccgtgaaaactatttacaaaactgcatgatcgagctgaaccgt
attgagctcatgcaacaagcacagcaactttctttactttcgcagcaagatgcacttaca
ggtttagccaatcgccgctatttagatgaaacacttgataatgaatggcgccgtgcatta
cggcatgaaacaccactcacaattatgatggtcgatatcgattattttaaagcatacaat
gacacgctaggacatctcaaaggtgatgaatgtttaaaagaaatcgcaattgctatttct
tctattgctgcacgtagtggtgatttagttgctcgttatggtggcgaagagttcttacta
ttattcccaatgacaaatgcgcagcaagctttaatacaggtcgaacgtttaatgagtgcg
attaataaaattgcgattaagcatccatgtagtgatgtttcaccttatgtcaccattagc
gtaggagtcgcaactacaattccacggctaaacgattcaatttctgcttttgttgcacga
gctgaccatgccttatacaaagcgaaaacaaatgggcgtaatcaatataaaattgctgta
aatgaagaacaaattgtagatttaacttaa

DBGET integrated database retrieval system