KEGG   Acinetobacter lactucae: OTEC02_13050Help
Entry
OTEC02_13050      CDS       T05220                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
alc  Acinetobacter lactucae
Brite
KEGG Orthology (KO) [BR:alc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    OTEC02_13050
Enzymes [BR:alc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     OTEC02_13050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO FAD_binding_3 NAD_binding_7 Thi4 AlaDh_PNT_C NAD_binding_8 K_oxygenase Cytochrom_C_2 FMO-like Spermine_synth Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ARD30814
UniProt: A0A1V0KGI9
LinkDB All DBs
Position
2729129..2730694
Genome map
AA seq 521 aa AA seqDB search
MLDQNIKTQLKAYLERLESPIELVAALDESDKAAQIKELVSEIAELSDKVTARFDGNNTR
RPSFGVAKAGEQPRVFFAGLPMGHEFTSLILALLQVSGYAPKVSDDVLNQIKGLNLKANF
DVFVSLSCHNCPDVVQALNLIAIYNPNTTATMIDGSFFQDEVEQRKIMAVPMVFQDNEHI
GQGRMTLEEIVAKLDTNSAEKDAAALNAKDTFDVLVIGGGPAGATAAIYAARKGINTGIV
AERFGGQVMDTMDIENFTSVQKTQGPKFAAEMEAHVREYDVDIMNLQRVSKITGANQTAN
GLVEVELENGAKLESKTVILSTGARWREMNVPGEQEYRTRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLVEFDTKLRADQVLQNKLHSLPNTTVIMNALSTEVLGD
GSQVTGLKYKDRATDEEHVVELAGIFVQIGLLPNTDFLKDSEVELTNRGEIIVNDRNETN
VQGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYIIRSGQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaaaacattaaaactcaattaaaagcttacttagaacgtttagaaagtcca
atcgaattagttgctgctttagatgaatcagataaagctgctcaaattaaagaactagtg
agtgaaatcgctgagctttctgacaaggtgactgcccgttttgatggcaacaatacacgt
cgtccaagctttggtgtggctaaagcaggtgaacaacctcgtgtgttctttgctggctta
ccgatgggccatgagtttacgtctttgatcttggcactgttacaagtgtctggctatgca
cctaaagtgtcggacgacgttttaaatcagattaaaggtttaaacctcaaagcaaacttt
gatgtgtttgtatccttaagctgtcataactgtccggatgtagtacaggcgcttaacctg
attgccatttataacccgaacaccacggcaaccatgattgacggttcattcttccaagac
gaagtggaacaacgcaaaatcatggctgtgccaatggtattccaagacaacgaacacatt
ggtcaaggtcgtatgacccttgaagagattgtggcgaaacttgatactaactcagctgaa
aaagatgcagcagcactgaatgccaaagatacttttgatgtattggtaattggtggtggt
cctgcgggtgcaacagctgcaatctatgcggcacgtaaaggcattaatacaggtatcgtg
gctgaacgctttggtggccaggtcatggataccatggacattgaaaacttcacttctgtg
caaaagacgcaaggtcctaagtttgctgccgaaatggaagcacatgttcgtgaatacgat
gtcgatatcatgaacttgcaacgtgtcagcaaaatcacaggtgcaaaccagactgcaaat
ggcttagttgaagttgaacttgaaaacggtgcaaaacttgaatcgaaaaccgtaatcctt
tcaacaggtgcacgttggagagaaatgaatgtaccgggtgagcaagaataccgtacccgt
ggtgttgcatactgcccacactgtgatggtccattgtttaaaggcaaacgtgttgcagtg
attggtggcggtaactcaggtgttgaagcagcgattgaccttgcagggattgttgagcat
gtgactctggttgaattcgataccaaacttcgtgctgaccaagtattgcaaaacaaattg
catagcttgccaaacaccactgtgattatgaatgctttaagtacagaagtgctgggtgat
ggttcacaagtgactggtcttaaatataaagaccgtgcgactgacgaagagcatgtggtc
gagcttgcagggatctttgtacagattggtttactaccaaacactgacttcttgaaagac
agtgaagttgagttaaccaatcgtggtgagatcattgtcaatgaccgcaacgaaaccaat
gtacaaggtgtatttgctgcaggtgactgtaccactgtgccttacaagcaaatcattatt
gccacaggtgaaggcgctaaagcatcactctctgcgtttgattacatcatccgttctggg
cagtaa

DBGET integrated database retrieval system