KEGG   Acinetobacter lactucae: OTEC02_13385Help
Entry
OTEC02_13385      CDS       T05220                                 

Definition
(GenBank) hypothetical protein
Organism
alc  Acinetobacter lactucae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3237
Motif
Other DBs
NCBI-ProteinID: ARD29689
UniProt: A0A1V0KDE7
LinkDB All DBs
Position
2813515..2814051
Genome map
AA seq 178 aa AA seqDB search
MKKVVTLLCGICFIGLTHAETQYSPPPIQLEPLAKFSVDLNAPVWELGTTSDAGKRRIIP
ITGGTFEGKSLKGRILNNGADWQIVDSKGLAIIDTRYLLETDDGALIYLQTKGYRHGSAE
TLKQLAQGKDVDPKNYYFKITMQFETSSPKYSWLNQTVAVGSAMRLGKAVIYDAYTLK
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagttgtaacgttactctgcggaatttgtttcattggcctgactcatgccgaa
acgcaatatagccctccacctattcagcttgagcctttagcaaaatttagtgttgatcta
aacgcacctgtttgggaattaggcacgaccagtgatgcaggtaaacgccgaattattccc
attacaggtgggacatttgaaggcaaatcacttaagggccgcattttaaataatggtgca
gattggcaaattgtcgacagtaaaggattggccattattgatacacgatatttgttagaa
accgatgatggtgcacttatttatcttcaaaccaaaggttacagacatggctcggcagaa
acactaaaacagcttgcccaaggcaaagatgtcgatccgaaaaattactatttcaaaatt
accatgcagtttgaaaccagctcacctaaatattcatggcttaaccaaacagttgcagta
ggtagtgcaatgcgtttgggcaaagcggttatttatgatgcctataccctgaaataa

DBGET integrated database retrieval system