KEGG   Acinetobacter lactucae: OTEC02_13415Help
Entry
OTEC02_13415      CDS       T05220                                 

Definition
(GenBank) glucarate dehydratase
  KO
K01706  glucarate dehydratase [EC:4.2.1.40]
Organism
alc  Acinetobacter lactucae
Pathway
alc00053  Ascorbate and aldarate metabolism
alc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    OTEC02_13415
Enzymes [BR:alc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.40  glucarate dehydratase
     OTEC02_13415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: ARD29695
UniProt: A0A1V0KDE2
LinkDB All DBs
Position
complement(2820083..2821417)
Genome map
AA seq 444 aa AA seqDB search
MATSTPIVKSIRAIPVAGHDSMLLNLSGAHGPYFTRNILIIEDNSGNIGVGEIPGGEKIL
ATLNDAKALVEGQPIGEYKNLLKKIQQTFADRDSGGRGNQTFDLRTTIHVVTAYESALLD
LLGKHLNVNVASLLGEGQQRSEVEVLGYLFFIGDRKQTSLDYATTPQHHHDWYKVRHEKA
LTSESVQRLAEASYDRYGFKDFKLKGGVLQGEQEAEAVTAIARRFPEARVTLDPNGAWFL
DEAIALGKHLKGVLAYAEDPCGAEQGYSSREIMAEFKRATGLPTATNMIATDWREMSHSI
QLQAVDIPLADPHFWTLEGSVRVSQLCNMYNLTWGSHSNNHFDISLAMFTHVAAAAVGKV
TAIDTHWIWQEGTDQLTKAPLEIKDGKIQVPTAPGLGVELDWDRINQAHELYKLKGLGAR
NDADAMQFLIPNWSFNNKKPCLVR
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctctacacctatcgttaaatcaattcgagcaattcctgttgctggacatgac
agtatgctgctcaatttgagtggtgcccatggaccttatttcactcgtaacatacttatt
atcgaagataattctggaaatattggtgtaggtgaaattccgggtggagaaaaaatttta
gcgacattaaatgatgctaaagccttggtagaagggcagccgattggtgaatataaaaat
ctacttaaaaaaattcagcaaacttttgctgaccgtgacagtggtggccgaggcaatcaa
acctttgatttacgtaccacaattcatgttgtaacggcttatgaatcagcattacttgat
ttgcttggtaagcatttaaatgtgaatgtcgcaagtttgcttggtgaaggtcagcaacgt
agtgaagttgaagttttaggatatttgttctttatcggtgaccgaaaacagacttcatta
gactatgcgacaacacctcagcatcaccatgattggtataaagttcgtcatgaaaaagcg
ttaacatcagagtcggtgcagcgtttagcagaagcatcttatgaccgttatggttttaaa
gactttaaattaaaaggtggtgtattacagggcgaacaagaagctgaagctgttacagct
attgcgcgccgttttccagaagcacgtgtgacgcttgatccaaacggtgcatggttttta
gacgaagcaattgctttaggcaaacatcttaaaggggtgttggcctatgcagaagaccca
tgcggtgcagaacaagggtattcaagccgtgaaattatggccgagtttaaacgtgcaaca
ggtttacctacggcgaccaatatgattgctacggattggcgagaaatgtcgcatagtatt
caattgcaagctgttgatattcctttggctgatccacatttctggacattggaaggttcg
gttcgagtatcgcagctctgcaatatgtacaatttaacgtggggttcgcattctaataat
cactttgatatttcacttgcgatgtttacccatgttgcagccgccgcggtaggtaaggtt
acggcaattgatacacactggatttggcaagaaggtacagatcagctaacgaaagcgccg
cttgaaattaaagatggtaaaattcaggtgccgacagcaccgggacttggggttgagctg
gactgggatcgaattaatcaagcccatgaactgtataaattaaaaggtttaggggctcgt
aatgatgccgatgcgatgcaatttttaataccaaattggtcgttcaataataaaaagccg
tgtttggttcgttaa

DBGET integrated database retrieval system