KEGG   Acinetobacter lactucae: OTEC02_13435Help
Entry
OTEC02_13435      CDS       T05220                                 

Definition
(GenBank) AraC family transcriptional regulator
Organism
alc  Acinetobacter lactucae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arabinose_bd HTH_18 HTH_AraC HTH_11 Sigma70_ECF MarR_2 HTH_24 HTH_50 HTH_AsnC-type HTH_30 HTH_8
Motif
Other DBs
NCBI-ProteinID: ARD29699
UniProt: A0A1V0KDF6
LinkDB All DBs
Position
complement(2825716..2826786)
Genome map
AA seq 356 aa AA seqDB search
MPNNLYKNANSVIEANYDNTSLGANTYLLGLTSLFDEMGLQGHSISDVLSGTNISPDALN
ESSLYISQVQKIQLFHNIQKLSHDPLIGLRAGQKQRLSDFGVYGYALYSSRNFRQAVELG
IRHIKLAGPILKKSFYIRDDVAIFEGQDIITLGKLLPLVCEFWFSSMQTLIERVLEGPFQ
AKKLLLPYPAPDYAEEYEKVFHCPVQFNAGVMQWYFDLKWLDVPCPNANPITADMCKSFC
ERMLGAAELEEPELVKTIRLILLDGTGLFPSAQEMAERLHMSKRTLHRRLAGFDLTYQEL
LDETRRRLADEYLRETTLTVDEIAERIGFSDTSNFRKAYRHWTGISPNEYRIQYLN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcctaataatctttataaaaatgcaaatagtgttatcgaagcaaattatgataataca
tccttaggtgccaatacatatttgctaggtttaaccagtttgtttgatgaaatgggtttg
caaggccattcaatatcagatgttttatctggcacaaatatttcgcctgatgcgttgaac
gaatcctctttatatatttctcaagtccaaaaaattcagctatttcacaatattcaaaag
ctatctcatgatccgctcattggactacgcgcagggcaaaagcagcggttatcagatttt
ggggtgtatggttacgcactttactcttcacgtaattttagacaagcggtagagcttggc
attcgacacattaaacttgcagggcctattttaaagaaatctttttatattcgagatgat
gttgcgatttttgaagggcaggacattattacactgggtaagcttctgcctttagtgtgc
gagttttggtttagctccatgcaaaccttaattgaacgtgtgcttgaaggaccatttcaa
gccaagaagcttttgttgccctatccagcgcctgactatgcagaagaatatgaaaaagtc
tttcattgtcctgttcagtttaatgctggagtgatgcaatggtactttgatttaaagtgg
ctcgatgtaccttgtccaaatgccaacccgattaccgctgatatgtgtaagtcgttttgt
gagcggatgctaggtgctgctgaacttgaagagcctgaattggtgaaaacaatccgttta
atattattggatggaacagggcttttcccatcggcccaagaaatggctgaacgcttacat
atgtcaaagcgtaccttacatcggcgcttggcaggttttgatttaacctatcaggaactg
ttagatgaaactcggcgccgtcttgccgatgaatatttgcgagaaacaactttaaccgta
gatgaaattgctgagagaattggcttttcagatacctctaattttagaaaagcctatcgt
cactggacaggcatttcaccaaatgagtatcgaatacagtacctaaattag

DBGET integrated database retrieval system