KEGG   Alteromonas sp. Mac1: AV939_00335Help
Entry
AV939_00335       CDS       T05687                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
ale  Alteromonas sp. Mac1
Pathway
ale00260  Glycine, serine and threonine metabolism
ale01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ale00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AV939_00335 (tdh)
Enzymes [BR:ale01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     AV939_00335 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 FAD_binding_3 Methyltransf_25 HI0933_like Pyr_redox_2 Pyr_redox_3 FAD_oxidored FAD_binding_2 AdoHcyase_NAD 2-Hacid_dh_C Pyr_redox TrkA_N
Motif
Other DBs
NCBI-ProteinID: AMJ85165
LinkDB All DBs
Position
71369..72394
Genome map
AA seq 341 aa AA seqDB search
MKSLVKAKAEKGIWLQDTQEPEVGHNDLLIKIRKTAICGTDMHIYNWDEWSQQTIPVPMV
VGHEYVGEVVGMGQEVRGFAIGDRVSGEGHITCGHCRNCRAGRRHLCRNTEGVGVNRSGA
FAEYLVIPAFNAFKIPDNISDELASIFDPFGNAVHTALSFDLVGEDVLITGAGPIGIMAA
AVARHVGARHVVITDINPYRLELARKMGATRAVDVSKEDLQDVMNELGMSEGFDVGLEMS
GVPVAFRDMLKKMNHGGKVAMLGIPPQDVSVDWNQVIFKGLVIKGIYGREMFETWYKMAS
LLQSGLDLSPIITHTFSVDDFQKGFDTMGSGQSGKVILDWQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgttagttaaagcaaaagctgaaaaaggcatttggcttcaagatacccaagag
cctgaagttggccataacgatttattaatcaaaattcgtaaaaccgccatttgcggcacc
gacatgcacatttacaactgggatgaatggtcgcagcaaaccatacctgtacctatggta
gtaggtcacgagtacgtaggtgaagtggttggcatgggccaagaagtacgtggatttgct
attggtgacagagtatctggtgaaggccatattacatgcggacattgcagaaactgccgt
gcaggccgtcgccatttatgccgcaacaccgaaggcgttggcgtaaatcgctctggtgcc
ttcgcagagtatttggttattcctgcgtttaacgcatttaaaattcccgataatattagt
gatgaactggcatctattttcgacccatttggtaatgctgtgcacaccgcccttagcttc
gacttagtgggtgaagatgtattaattaccggtgctggtcctattggtattatggcagct
gcagtggcgcgtcacgttggtgcgcgtcatgtggttatcaccgacatcaacccgtatcgc
ttagagcttgctagaaagatgggcgcaactcgcgccgttgatgttagcaaggaagacttg
caagacgtgatgaacgagcttgggatgagtgaaggctttgatgttggccttgaaatgtcg
ggcgtaccggtagcctttcgcgacatgctaaagaaaatgaatcacggcggaaaggtggca
atgctaggtattccaccacaagatgtatcggttgattggaaccaagttatttttaaaggg
ttagtgatcaaaggtatctacggtcgtgaaatgttcgaaacctggtacaaaatggcaagt
ttgctgcaaagtggcttagatttgtcgccaatcatcacacataccttttcggttgatgac
tttcagaaaggttttgataccatgggttcaggacaatcaggcaaagttatactggactgg
caataa

DBGET integrated database retrieval system