KEGG   Alteromonas sp. Mac1: AV939_02095Help
Entry
AV939_02095       CDS       T05687                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
ale  Alteromonas sp. Mac1
Pathway
ale00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ale01100  Metabolic pathways
ale01110  Biosynthesis of secondary metabolites
ale01130  Biosynthesis of antibiotics
ale01230  Biosynthesis of amino acids
Module
ale_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ale00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AV939_02095 (aroK)
Enzymes [BR:ale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     AV939_02095 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI Cytidylate_kin2 AAA_18 AAA_33 Cytidylate_kin AAA_16 AAA_24 AAA_22 ABC_tran dNK AAA_25 AAA APS_kinase TsaE Ploopntkinase3 AAA_17 AAA_29 AAA_7 RNA_helicase AAA_5 RsgA_GTPase Guanylate_kin PduV-EutP AAA_PrkA
Motif
Other DBs
NCBI-ProteinID: AMJ85475
LinkDB All DBs
Position
complement(517822..518337)
Genome map
AA seq 171 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRHLADELHLDFYDSDQEIERRSGADIAWIFDLEGEDGFR
AREENIINDLTDKQGIVLATGGGSIVTKAVRNRLSARGIVVYLQTTIDKQVARTQRDKRR
PLLQNDDPEQVLRDLADLRNPLYEEVADYVVDTDDQSARAVANQIISKIGL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaaacgtaatatctttttggttggcccaatgggtgctggcaaaagtaccatc
ggtagacacctggcagacgaacttcacctggatttttatgactccgatcaggaaatagag
cgccgttctggtgctgatatcgcctggatcttcgaccttgaaggcgaagatggattccgt
gcacgtgaagaaaacatcatcaatgatttaacagacaagcagggtatcgtgcttgccact
ggcggcggttcaattgtaaccaaagcagtacgtaatcgtttgtctgcacgaggcattgtt
gtttacttgcaaactacgattgataagcaagttgctcgaacacagcgcgataagcgtcgc
cctttgcttcaaaacgacgatccggagcaagtacttcgcgatctagcagatttgcgtaat
cctctttacgaagaagttgcagattatgtagttgatactgatgaccaatctgctcgcgca
gtggcaaatcagatcattagtaaaatcggtttataa

DBGET integrated database retrieval system