KEGG   Alteromonas sp. Mac1: AV939_06955Help
Entry
AV939_06955       CDS       T05687                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ale  Alteromonas sp. Mac1
Brite
Enzymes [BR:ale01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     AV939_06955
Peptidases [BR:ale01002]
 Metallo Peptidases
  Family M2
   AV939_06955
Exosome [BR:ale04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AV939_06955
CD molecules [BR:ale04090]
 Proteins
  AV939_06955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AMJ86348
LinkDB All DBs
Position
1643219..1645042
Genome map
AA seq 607 aa AA seqDB search
MFSTKRTIVAALVSITLIGCGEATSKTETIPAAPTAQDAQEFLINAQNDISKMQVPAAHA
EWSYATNINFDTAAVSAYFNEVLSTKVAVLAKEAAKFNDVEVDEDTRRQLNLLKNGLTMP
PPSDPAKAEQLAKIGSELSAMYGSGQYCMEDGTCKSLVEMSSEMATIRDADTLLEYWKGW
REVSVPMKPLYEQQVNLANEGAAELGFQNVSELWRGKYDMPADDFPKELDRLWGQVAPFY
ESLHCHVRAKLGEHYGEELVPQDQPIPAHLLGNMWAQTWGNVYDIVKPEQEMSVPDVTSS
LEAQGYDEIKMVKQAESFFSSLGFAPLPDTFWERSMFQKPEGRDAQCHASAWDLDDKDDL
RIKMCIQKTGEEFNVIHHELGHNYYQRAYKDQPLLYRGSANDGFHEAIGDTIALSITPKY
LKEIGLIDEIPDASNDIGMLMQVALDKIAFIPFGLMVDQWRWKVMAGEVSPEQYNTLWWE
LREKYQGVKAPIDRPADAFDPGAKYHVPANVPYTRYFLAHILQFQFHKALCDIAGDEGPL
NRCSIYNSEEAGTALNAMLEMGVSEPWQNALETLTGSPEMDASTIADYFAPLKTWLDEQN
ATRQCGW
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaactaaacgcactatcgtcgcagcactagttagcattacgctaataggttgc
ggtgaagccactagcaaaactgaaacaatacctgcggcacctaccgcgcaagatgcgcaa
gaatttcttattaatgcgcaaaacgatattagtaaaatgcaggtaccagccgctcatgcc
gagtggagttacgctactaacatcaattttgataccgccgcagtaagtgcctatttcaat
gaagtactgtccaccaaagtagcggtgttagccaaagaagcggctaaatttaacgatgtt
gaagttgatgaagatacccgtcgtcaacttaacctgcttaaaaacgggctgaccatgcca
cctccttcagatccggcgaaagcagaacaacttgctaaaattggttctgagctaagtgca
atgtatggttccggccagtactgcatggaagatggcacctgtaaaagcttggtagaaatg
agcagtgaaatggcgactattcgcgatgccgacaccttactagagtactggaaaggttgg
cgcgaagtgtctgtgcctatgaagccgctgtatgaacaacaggtaaatttggctaacgaa
ggtgctgctgaattaggctttcaaaatgtgagcgaactatggcgcggtaaatacgatatg
ccagccgacgacttcccgaaagaacttgataggttgtggggacaagttgcgcctttctac
gaatcgctgcactgccacgttcgtgctaagttaggtgagcattatggtgaagaattggtt
cctcaagaccaaccaattccagcgcacttgttaggcaatatgtgggcgcaaacctggggc
aacgtttacgatatcgtgaagcctgaacaagaaatgtcagtacccgatgttacttcatcg
ctcgaggctcagggctatgatgaaataaaaatggtaaaacaggctgaatctttcttttcg
tcattgggctttgcgccgctgcctgatacgttttgggagcgctctatgttccaaaaacct
gaaggccgcgacgcacagtgtcacgcttcagcatgggacttagatgacaaagacgattta
cgtattaagatgtgtattcaaaaaacgggggaagagtttaacgttattcatcatgaactg
ggtcacaactattaccaacgtgcttataaagaccagcctttgctgtatcgcggttcagct
aacgatggcttccatgaagcgattggcgacaccattgccttgtcgattacccctaagtac
ttaaaagaaattggtttgattgacgagatcccagatgcgtctaacgacataggcatgcta
atgcaggtggcgctagataaaattgcctttattccatttggtttgatggtggatcaatgg
cgctggaaagtgatggccggtgaagtatcgcctgagcaatacaatacactttggtgggaa
ttaagagaaaagtaccaaggtgtaaaggctccgatagacaggcctgcagatgcgtttgac
ccaggcgctaaatatcatgttccggctaacgtgccctacactcgctacttcttagcgcat
attttgcaattccagttccataaagccttgtgtgacattgccggtgacgaaggcccactt
aatcgctgttctatttataacagtgaggaagcgggtaccgcgctaaacgccatgcttgaa
atgggcgtaagtgaaccatggcaaaatgcgttagaaactcttactggctcacctgaaatg
gatgcaagtaccattgctgactactttgcaccgctaaaaacgtggttagatgagcaaaat
gcgacgcgtcagtgtggatggtaa

DBGET integrated database retrieval system